KEGG   Mus musculus (house mouse): 107589
Entry
107589            CDS       T01002                                 
Symbol
Mylk, 9530072E15Rik, A930019C19Rik, AW489456, KRP, MLCK108, MLCK210, Mlck, nmMlck, smMLCK
Name
(RefSeq) myosin, light polypeptide kinase
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04921  Oxytocin signaling pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107589 (Mylk)
   04020 Calcium signaling pathway
    107589 (Mylk)
   04022 cGMP-PKG signaling pathway
    107589 (Mylk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107589 (Mylk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107589 (Mylk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107589 (Mylk)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107589 (Mylk)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107589 (Mylk)
  09154 Digestive system
   04971 Gastric acid secretion
    107589 (Mylk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    107589 (Mylk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     107589 (Mylk)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   107589 (Mylk)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 Pkinase 23ISL V-set PK_Tyr_Ser-Thr C2-set_2 fn3 Ig_C17orf99 Kinase-like Kdo DUF5898 AvrM_N
Other DBs
NCBI-GeneID: 107589
NCBI-ProteinID: NP_001395190
MGI: 894806
Ensembl: ENSMUSG00000022836
Position
16:34565569..34822806
AA seq 1941 aa
MGDVKLFASSHMSKTSHSVDPSKVSSMPLTEAPAFILPPRNLCVKEGATAKFEGRVRGYP
EPQVTWHRKGQAITNGGRFLLDCGVRGTFSLVIHTVREEDKGKYTCEASNGSGARQVTVE
LTVEGNSMKKRDQPVLSKASGFPGETRPSIWGECPPKFATKLGRAVVKEGQMGRFSCKIT
GRPPPQVTWLKGNVPLQPSARVSMSEKNGMQILEIRGVTRDDLGVYTCMVVNGSGKASMS
AELSIPGLDNAARLAVRGTKAPSPDIRKEVTNGVSKDPETVAESKNCPSPQRSGSSARAT
NSHLKSPQEPKPKLCEDAPRKVPQSSILQKSTSTITLQALKVQPEARVPAIGSFSPGEDR
KSLAAPQQATLPTRQSSLGGSVGNKFVTGNIPRESQRESTFPRFESQPQSQEVTEGQTVK
FICEVSGIPKPDVGWFLEGIPVRRREGITEVYEDGVSHHLCLLRARTRDSGRYSCTASNS
LGQVSCSWSLLVDRPNLAQTAPSFSSVLKDSVVIEGQDFVLRCSVQGTPAPRVTWLLNGQ
PIQFAHSICEAGVAELHIQDALPEDRGTYTCLAENAMGQVSCSATVTVQEKKGEGEREHR
LSPARSKPIAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHDGNEIQESEDFHFE
QKGGWHSLCIQEVFPEDTGTYTCEAWNSAGEVRTRAVLTVQEPHDGTQPWFISKPRSVTA
TLGQSVLISCAIAGDPFPTVHWLRDGRALSKDSGHFELLQNEDVFTLVLKNVQPWHAGQY
EILLKNRVGECSCQVSLMLHNSPSRAPPRGREPASCEGLCGGGGVGAHGDGDRHGTLRPC
WPARGQGWPEEEDGEDVRGLLKRRVETRLHTEEAIRQQEVGQLDFRDLLGKKVSTKTVSE
DDLKDIPAEQMDFRANLQRQVKPKTISEEERKVHSPQQVDFRSVLAKKGTPKTPVPEKAP
PKAATPDFRSVLGGKKKSPSENGGNSAEVLNVKAGESPTPAGDAQAIGALKPVGNAKPAE
TPKPIGNAKPTETLKPVGNTKPAETLKPIANAQPSGSLKPVTNAQPAEPQKPVGNAKSAE
TSKPAGKEEVKEVKNDVNCKKGQVGATGNEKRPESQGSAPVFKEKLQDVHVAEGEKLLLQ
CQVISDPPATVTWSLNGKTLKTTKFIVLAQEGSRFSVSIEKALPEDRGLYKCVAKNSAGQ
AECSCQVTVDDAQTSENTKAPEMKSRRPKSSLPPVLGTESDATVKKKPAPKTPTKAAMPP
QIIQFPEDQKVRAGEPVELFGKVAGTQPITCKWMKFRKQIQESEHIKVENGESGSKLTIL
AARQEHCGCYTLVVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYD
GGSAVQSYNVEIWDTEDKVWKELATCRSTSFNVQDLLPDREYKFRVRAVNVYGTSEPSQE
SELTAVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTVNTEQKVSDVYDIEERLGSGKFGQV
FRLVEKKTGKIWAGKFFKAYSAKEKDNIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVL
EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTG
TRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGL
SPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPW
LMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPT
SPINAEKLESEDDVSQAFLEAVAEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDP
EVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELI
VETMEEGEGEEGGEEEEEEEE
NT seq 5826 nt   +upstreamnt  +downstreamnt
atgggggacgtgaaactgtttgcctcgtcacacatgtctaaaacctcccacagtgtggat
ccctcgaaggtcagctccatgcctctcaccgaggccccagctttcattctgccccctcgg
aacctctgcgtcaaagaaggagccacagccaagttcgaagggagggtccggggctaccca
gagccccaggtgacatggcacagaaaagggcaagccatcaccaatggtggccgcttcctg
ctggactgtggagtgcgggggacttttagtcttgtcatccacactgtccgcgaggaggac
aagggcaaatacacctgtgaagctagcaatggcagtggcgcccgccaggtgaccgtggag
ctgactgtggaagggaattctatgaagaagcgtgatcagcctgttctttctaaagcctca
ggatttccaggggagactcgtcctagcatctggggtgagtgcccaccaaagtttgccacc
aagctgggcagagctgtggtcaaagaagggcagatggggcgattctcctgcaagatcact
ggccggcctccaccacaggtcacctggctcaagggaaatgtcccgttgcagccaagtgcc
cgtgtgtcaatgtcagagaagaatggcatgcagatcctggagatccgtggggtcactcgg
gatgacctgggcgtgtacacctgcatggtggtgaatgggtcagggaaagcctccatgtcg
gcggagctctccatcccaggtttggacaatgccgctaggttggctgtgagaggaaccaaa
gcccccagtccagacatcaggaaggaggtgaccaatggagtctccaaagacccagagact
gtggctgaaagtaagaactgtccaagtccccagaggagtggctcctcagcccgggccacc
aacagtcacctcaagtccccgcaggagcccaagccaaagctgtgtgaggatgctcccaga
aaggtcccgcagtcctccatcctgcagaagtccaccagcaccatcactctgcaggccttg
aaagtccagccagaagcgagagtaccagccatagggtccttctctcctggggaagacagg
aagagtctggctgcccctcagcaagccacactccctaccagacagtctagcctgggaggt
tccgttgggaacaagtttgttaccgggaacatccccagagagagccaaagggagtcaaca
ttccccagatttgagagtcagccccaaagccaggaagtcactgaaggtcagacagtcaag
ttcatctgcgaggtttcaggtataccaaagcctgacgtgggctggttcctggaaggcatc
cccgtgaggagacgggaaggcatcactgaggtttatgaagatggtgtatcccatcacctg
tgcctgctgagagcccggacgagagacagtgggaggtacagctgcacagcatccaatagc
cttggccaggtgtcctgcagctggagcctgctggtggaccggccgaacttggcacagaca
gccccttcattctctagtgttctgaaggacagtgttgtcattgagggccaggattttgtg
ctacggtgctcagtgcaggggactccagcaccccgggtcacgtggctgctcaatggacag
cccatccagtttgctcactccatctgtgaggcaggcgtggctgagctccacatccaggat
gccctgccagaggaccgtggcacctacacctgcctggctgagaatgccatggggcaggtg
tcctgcagcgccactgtcaccgtccaagagaagaaaggtgaaggagagagggaacaccgt
ctgtccccagctcgcagcaagcccatcgcacccatcttcctgcagggcctctccgacctc
aaagtcatggatggaagccaggtcactatgacagtccaggtgtcagggaacccacctccg
gaagtcatctggcttcacgacgggaatgagattcaggagtccgaggacttccacttcgag
cagaagggtggctggcacagcctgtgtatccaggaggtgttcccggaggacacgggcacg
tacacctgtgaggcctggaacagtgccggggaggtccgcacccgggccgtcctcaccgtg
caagagcctcatgatggcacccagccctggttcatcagcaagcctcgttcggtgacagcc
accctgggccagagtgtcctcatctcctgcgccatagctggagacccctttcccaccgtg
cactggctccgggatggcagagccctctccaaggacagtggccactttgagctgctccag
aatgaggacgtgttcaccctggttctaaagaacgtgcagccctggcatgccggccagtat
gagattctgctcaagaaccgggttggcgagtgtagttgccaagtgtcactgatgcttcac
aacagcccttccagagccccaccacgggggcgggagcctgccagctgcgagggcctctgt
ggtggtggaggagttggtgctcatggtgatggtgaccgtcatgggaccctgaggccctgc
tggccagcaagagggcaaggttggcctgaggaggaagacggagaagacgtgagggggctg
ttgaagagacgggtggagaccaggctgcacacagaagaggccatccgccagcaggaggtg
gggcagctggattttcgagacctcctgggaaagaaggtgagcaccaagaccgtctcagaa
gacgacctgaaggacatcccagccgagcagatggatttccgcgccaaccttcagcggcaa
gtgaagccaaagaccatatccgaggaagagaggaaggtgcatagccctcagcaggttgac
ttccggtctgtcctcgccaagaaggggacccctaagacccccgttcctgagaaggcacct
ccaaaagctgccaccccagactttcgctctgtgctaggtggcaagaagaagtcaccctcg
gagaatgggggcaacagcgctgaggtcttgaatgtcaaggctggggaaagccccacacct
gcaggcgatgcgcaggccatcggggccctgaaacccgtaggcaatgccaagcctgctgag
accccgaaacctataggtaatgccaagcctaccgagaccctgaagcctgtgggcaacacc
aagcctgccgagaccctgaaacccatagccaacgcacagccttcagggtccctgaaacct
gtaaccaacgcacaacctgctgagccccagaagcctgtgggcaatgccaagtctgctgag
acctcgaaaccagctgggaaagaagaagtcaaggaggtaaagaatgatgtgaactgtaag
aaagggcaggtcggagccacgggcaatgaaaagcgacccgagagccaaggctcggcccca
gttttcaaggaaaagctacaagatgtccatgtggcagagggggagaagctgctactccaa
tgccaggtgatctctgatccccccgccactgtcacctggtcgctgaatgggaagacactc
aagaccacaaaattcatcgtcctcgcccaagaaggctcacgtttctctgtctccatcgag
aaggcactgcctgaggaccgaggtttgtacaagtgtgtagccaagaacagcgctggccag
gcagagtgttcctgccaagtcactgtggacgatgctcagaccagtgagaacaccaaggcc
ccggagatgaaatcccggagacccaagagctctcttccccctgtgctaggaacagagagc
gacgcaactgtgaaaaagaaacctgcccccaagacacccacaaaagcagctatgccccct
caaatcatccagttccccgaggaccagaaggtgcgcgcaggagaacctgtggagctgttt
gggaaagtggctggcacccagcccatcacctgcaagtggatgaagttccgaaagcagatc
caggagagcgagcatatcaaggtggagaatggcgagagcggcagcaagctcaccatcctg
gccgcgcggcaggagcactgtggctgctacacactggtggtggagaacaagctgggcagc
aggcaggcccaagtcaacctcacggtcgtggataagccagaccccccggctggcacacct
tgtgcttctgacattcggagttcctcactgaccctgtcctggtatggctcctcatatgat
gggggcagtgctgtacagtcctacaatgtggagatctgggacacagaggacaaggtgtgg
aaagagctagccacgtgccgcagcacctcttttaatgtccaagacctgctgcctgaccgc
gagtacaaattccgagtgcgtgcagtcaacgtctatggaaccagcgagccaagccaagag
tccgagctcacagctgtgggagagaaacctgaagagccaaaggatgaagtggaagtgtcc
gatgatgacgaaaaggaacctgaggttgattaccggacggtgactgttaacactgaacag
aaagtgtctgatgtgtatgacattgaagagcgactaggatctgggaagtttggacaagtc
ttccgacttgtggaaaagaaaactggaaaaatctgggcagggaaatttttcaaggcctat
tccgccaaggagaaagacaacatccgtcaggagatcagcatcatgaactgcctccaccac
cccaagctggtccagtgtgtggatgccttcgaagaaaaggccaacattgtcatggttctg
gagatcgtgtccgggggtgagctgtttgagcgtatcattgacgaggacttcgagctgacg
gagcgggagtgtatcaagtacatgaggcagatctcggaaggggtggagtacatccacaag
cagggcattgtgcacctggacctcaagcccgagaacatcatgtgtgtcaacaagacaggc
accaggatcaagctcattgacttcggcctggcacggagactcgagaacgctgggtctctg
aaggtcctctttgggaccccagagtttgtggctcctgaagtgatcaactatgagcccatc
ggctacgccacagacatgtggagcatcggggtcatctgctatattctggtcagcggactt
tctcccttcatgggtgacaatgataacgagaccttagccaacgtcacttcagccacctgg
gacttcgatgacgaggcattcgatgagatctccgatgacgcaaaggatttcatcagtaac
ttgctgaagaaagatatgaaaaaccgtctggactgcacccagtgccttcagcacccatgg
ctgatgaaagacaccaagaacatggaggccaagaagctgtccaaggaccggatgaagaaa
tacatggcaagaaggaagtggcagaaaacgggcaatgctgtgagagccatcgggagactg
tcctctatggcaatgatctcagggctcagtggcaggaaatcttcaacagggtcaccaacc
agcccaatcaatgcggagaaactagagtctgaagacgatgtctcccaagctttcctggag
gctgttgctgaggaaaagccccatgtgaaaccttatttctctaagaccatccgtgatctg
gaagtcgtggagggaagcgctgctagatttgactgcaagattgaaggatacccagaccct
gaggtggtctggttcaaggatgaccaatcaatcagggagtcccgccacttccagatagac
tacgacgaagacggcaactgctcgctcatcatcagcgacgtctgtggggatgatgacgcc
aagtacacctgcaaggctgtcaacagcctcggagaagccacctgcactgcggagctcatc
gtggagaccatggaggaaggggaaggggaggaggggggagaggaggaggaggaggaggag
gagtga

DBGET integrated database retrieval system