KEGG   Mus musculus (mouse): 110350
Entry
110350            CDS       T01002                                 

Symbol
Dync2h1, 4432416O06Rik, AI448217, D030010H02Rik, D330044F14Rik, DHC11, DHC1b, DHC2, Dnchc2, b2b414Clo, m152Asp, m407Asp, mDHC11
Name
(RefSeq) dynein cytoplasmic 2 heavy chain 1
  KO
K10414  dynein cytoplasmic 2 heavy chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04962  Vasopressin-regulated water reabsorption
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110350 (Dync2h1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    110350 (Dync2h1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110350 (Dync2h1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    110350 (Dync2h1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    110350 (Dync2h1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      110350 (Dync2h1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     110350 (Dync2h1)
SSDB
Motif
Pfam: AAA_6 DHC_N2 AAA_9 AAA_8 Dynein_C AAA_lid_11 AAA_5 Dynein_heavy DHC_N1 AAA_7 MT AAA_22 AAA_16 RsgA_GTPase AAA ABC_tran AAA_24 AAA_30 AAA_18 AAA_28 RNA_helicase AAA_29 ATPase_2 IstB_IS21 AAA_33 AAA_23 ERM
Other DBs
NCBI-GeneID: 110350
NCBI-ProteinID: NP_084127
MGI: 107736
Ensembl: ENSMUSG00000047193
Vega: OTTMUSG00000033489
UniProt: Q45VK7
Position
9 A1; 9
AA seq 4306 aa
MAGSLGDVRKLFLFTTTQNYFGLRPELWDQPPLSNCPEVNNFLDDGNQMLLRVQRSEAGL
AFSNTIDFDDAKDKVLVFFKLRPEVITDGNLHNNILVSSMLESPINSLYQAVRQVFAPML
LKDQEWSRNFDPKLQNLLSELEAGLGIVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWI
EQAHRGSKQISKERASYFKELFETISREFYNLDSLSLLEVVDLVETTRDVVDDVWRQTEH
DHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSH
LTGQVWQRYVPHPWKSGKYFPETLDKLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSR
VFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDSPQQLLQA
FLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCRGIPGDPSGPLSGKNLS
EVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSR
EVQSGLSDSRSGLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKI
QQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGK
SQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHTTFCEKVVILMNIDLLRQQQRWKD
GLQELRTGLATVAAQGFQASDMRAWRQHWNHQLYKALEHQYQVGLEALNENLPEINVDLT
YKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEAGDESIFSVMIDRNASGFLTIY
SKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLP
SAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIP
QSVEEIGDTNVQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFEL
MMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSA
KSIKEKKIEFDDLEVIRKKLVDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQG
LQDMAKEDWITYRAKIYLFEEFLINWHERLRKIEEHSVMTVKLQSEVDRYKMIIPILKYV
RGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASELKDLNSRAQGEVTI
REALRELDLWGVGAVFSLIDYEDSQNHTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKG
FEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMM
DIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEI
LGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPFKSKVLLSNNVEAWL
NDLALEMKQTLKQLLKECVTAGRSSQGAIDPSLFPSQILCLAEQIKFTEDVENAIKDHSL
HQIEAQLVAKLERYTSVDTSSEDPGNSESGILELKLKALILDIIHNIDIVKQLNQVQVHT
TDDWAWKKQVRFYMKSDHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMK
MGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCF
DEFNRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINANSGIFITMNPAGKGYGG
RQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQ
HYDWGLRALKTVLRGSGNLLRQLKKNSTKQDVNENHIVVQALRLNTMSKFTFADCTRFDA
LIKDVFPGIDFKEVEYDELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGP
SGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQ
VVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLS
CASPATISRMGMIFLSDEETDLNSLIKSWLRNQPLEYRSNLENWIGDYFSKALQWVLKQN
DYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETP
PDSHRPMDTYYDCDRGQLASYMLKKPESLTADDFSNGHILPVIQTPDMQRGLDYFKPWLS
SDTKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVIST
NTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENI
QIVASMSAGGRLGRHKLTTRFTSIVRLCAIDYPEREQLQTIYGAYLEAVLHKNLKNHSIW
GSSSKIYLLAGSMVQVYEQVRAKFTVDEYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPL
DYVLEIVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAHH
VSGGKTAPGQPLPPHGKPLGKLTSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRI
DRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRNDLKHVLQL
AGIEAQQVVLLLEDYQFVHPTFLEMINSLLASGEVPGLYTLEELEPLLLPLKDQASQDGF
FGPVFNYFTYRIQQNLHIVLIMDSANLNFIVNCESNPALHKKCQVLWMEGWSDSSMKKIP
EMLFSETDGEEKYEKKRKDEKKRNSVDPDFIKSFLLIHESCKAYGATPSRYMTFLHVYSA
ISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITV
SMQDASEQKTELERLKQRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLS
EIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRE
SVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLK
KTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDR
EHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLR
RFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSHLE
VINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIID
YNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTK
LLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKL
QISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSENTE
ERIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDML
RKADSQQRIRDQLPSWIDQERSWAVATLKISLPSLYQTLCLEDGAFWRTYYHHSMCEQEF
PSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYKETLEIE
PILIIISPGADPSQELQELASAERSSECYHQVAMGQGQADLAIQMLKECARNGDWLCLKN
LHLVVSWLPVLEKELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLM
RTYESWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYH
VIDRLFDGTKDVQWEFVHGLLENSIYGGRVDNYFDLRVLQSYLKQFFNSSIIDVLNQRNK
KSIFPYSISLPNSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQVISQLRIL
GRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQGSPILSFIILEQF
NAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSRWEGPEDPLQYL
RGLVARTLAIQNWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFV
ASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCYMGWTPQGSYGPY
SPDECISLPVYTSAERERVVTNIDVPCGGNQDQWIQCGAALFLKNQ
NT seq 12921 nt   +upstreamnt  +downstreamnt
atggcgggaagcctcggagatgtccgcaaactctttctttttacgaccacccagaattac
ttcgggctgagaccggagctctgggatcagcctccgttgagcaactgcccggaggtgaac
aacttcttggacgacgggaaccagatgctacttcgggtgcagcggtccgaagctgggctg
gccttttccaacacgattgattttgatgacgcaaaagacaaagtgctggtgtttttcaag
ctccgaccagaagtaattacagatggcaatctgcataacaacattctggtttcttctatg
ctggaatcacctatcaactccctttaccaagcagtacgacaggtgtttgcacccatgttg
ctgaaggaccaggaatggagcagaaactttgatcctaaacttcagaatcttttgagtgaa
ctagaagctggattgggtatagtcctacgaaaatcagatactaacttacccaagctgaaa
cttaaggaagacgatactagaggtattctcacaccaagtgatgagttccagttttggata
gaacaagctcatcgtggaagcaaacagattagtaaagaaagagccagttattttaaggaa
ttatttgaaacaatttcaagggaattttataacttggacagtctgtccttgctagaagtt
gttgacttggtggagacaactcgggatgttgtagatgatgtgtggcgacagacagagcat
gatcattaccctgagtcacgtatgctgcatctcctggatgtcataggtggttcatttgga
aggtttgttcagaaaaaattaggaagcttgaaactgtgggaagatccttattatctcgtg
aaagaaaaccttaaagctggcatttcaatttgtgaacaatgggtgatagtctgcagtcac
ctcacaggtcaggtgtggcagcgctatgtccctcatccatggaaaagtggaaagtatttc
ccagaaactcttgacaaactgggcaaacggctagaggaggtcttggctattcgaacaatt
catgagaagctcttgtactttttacctgccagtgaggagagaattgtatgcctgtctcgg
gtatttgagcctttcactggtgtgaaccccgtgcagtacaatccttatactgagccttta
tggaaagctgcagtgtctcagtatgaaaagatcattgcacctgcagaacagaaaatagca
gggaaattaaagaattatatttcagaaattcaagatagtccacagcagcttctccaagca
tttctaaaatacaaagaattggtgaagcgtcccactataagcaaagaactgatgttagag
agagagactttactggcaagacttggggattcagctaaagattttcgattggactttgag
aatcgatgccgaggaattcctggtgatccatctggaccactttctggcaaaaatctttca
gaagttgtgaataatattgtttgggttcgtcagttggaattgaaggtagacgatactatc
aagatagcagaagctcttttgtctgacttgtcaggatttcgatcttttcatcggagtgct
gaagatctcttggaccagttcaagctctatgaacaggaacagtttgatgactggtcaaga
gaagtccagtcagggttgtctgactccaggtcaggtctgtgtattgaggctaacagccga
ataatggaattggatcctaatgatggggcattaaaagtgcattattctgatcgcctggtg
attcttctgagagaagtccgtcagctttctgccctgggctttgtcattcctgcaaaaata
cagcaggttgcaaatgttgctcagaagttctgcaagcaagccatcattcttaagcaagtg
gcacatttttacaattccattgatcaacagatgattcagagtcagaggccaatgatgctg
cagtctgccttagcatttgaacagataattaaaaattcaaaagcagggagtggaggcaag
tcacagattacttgggacaaccctaaagaactagaaggctacatccagaaactacaaaat
gctgctgagcgacttgccacagagaatagaagactgagaaagtggcacactacattttgt
gaaaaggttgtcattcttatgaatattgatctgcttcggcagcagcagcgttggaaggat
ggactgcaggaactgagaactggcttagcgactgtggcagcgcagggcttccaagccagt
gacatgcgtgcgtggcggcagcactggaaccaccagctttacaaggcgctggagcaccag
tatcaagtgggtctggaggcgctcaacgagaacctgccggagatcaacgtagacttaacc
tacaaacagggaaggttacagtttcggcctccttttgaagaaatccgggctaaatattac
agagaaatgaagaggttcatcggaattcccaatcagtttaagggcgtgggtgaggctgga
gatgaatcaatattttctgtcatgattgatagaaatgcaagtggatttctgactatttac
agcaaagcagaagatctgtttagaagactgtcagcagttttgcatcaacataaggaatgg
gttgtgattggacaggttgacatggaagctctggttgaaaagaatctttctactgtgcat
gattgggagaaaaattttaaagcattgaaaataaaagggaaagaagttgaacggcttccc
agtgctgtcaaggtggactgtctgaacatcaactgcagccctgtgaagactgtgatcgat
gacctcatccagaagctctttgatctgcttgtcctttctctgaagaagtccatccagact
cacatacacgaaattgatacatttgttactgaggctatgaaggtcttaacagttatacct
cagtctgtggaagaaataggtgatacaaatgtacagtatagcaacctgcaggatcggagg
cctgagattttgcccttgtttcaagaagccgaagacaaaaacaggcttttgcgtactgta
gcaggtggaggggtagagacagttagcaatctgagagccaagtgggacaaattcgagctg
atgatggaaagtcaccaacttatgattaaagatcagattgaagtgatgaagggaaatgtg
aagtcccgccttcagatctattaccaagagctggacaagttcaaggctcgctgggaccag
ctgaaacctggggatgatattattgaaactggtcaacaaaataccatggatcaaagtgca
aagtctataaaggaaaaaaaaattgagtttgatgatctggaagtcataagaaaaaagcta
gttgatgactgccatcattttggactagaagagcctaacttctctctggcatatagcatc
tctaaggacattgagagctgtgcacagatttgggctctttatgaggagttccaacaaggg
ctccaggatatggccaaagaagattggattacttaccgggctaagatctacctgtttgag
gagtttttgattaactggcatgagagactaaggaagattgaagagcattcggttatgaca
gtgaagttgcagtcagaagtggacagatacaaaatgattattcctatcctgaaatatgtg
cgaggggagcatctttctccagaccactggcttgacctttttcgtctacttggccttcct
cgagggactagtctagagaaactgctgtttggtgacctgctcagagttgctgatacaatt
gtggagaaagcatcagagcttaaagatttaaatagtcgggcacaaggggaagttaccatc
agagaagctttgcgtgaacttgatctatggggagttggagcagtgttctcactgattgat
tatgaagacagccagaatcacactatcaagctgattaaagactggaaagacatagtgaac
caggttggagataatagatgccttcttcagtccttaaaagattctccatattacaaagga
tttgaagataaagtatcaatttgggaaagaaaacttgcacagttagatgagtacctgcag
aatttgaaccatatccagagaaaatgggtatatttggagcccatttttgggcgtggagct
ttgcctaaagaacagacacgcttcaacaaagttgatgaagacttcagatcaataatgatg
gacatcaggaaagacagtagagtcaccacattgactactcatgcaggaatcagaaacact
ctgctaacgatacttgatcagcttcaaagatgccagaaatccctaaatgaatttttggag
gaaaaacggtcagcattcccgagattttattttattggtgatgatgacttgttagaaatc
ctgggccagtcaactaacccatcagtgattcagtctcatctgaagaagctgtttgctggc
attaacagtgtgtgctttgatgaggaatctaaacatataactgcaatgaagtcactagag
ggagaagttgtaccttttaaaagtaaagttctcctatcaaataatgtagaggcatggttg
aatgatctggctttggaaatgaagcaaactctgaaacagttgttgaaagaatgtgttact
gctggacgaagttcacaaggtgcaattgacccatctctgttcccttcccagatactgtgt
ttggcagagcagatcaagtttactgaagatgtagaaaatgccatcaaagaccacagtctt
caccagattgaagcacaactggtggctaagttagagcgctacactagtgttgacacaagc
tctgaggacccagggaactcggaatcaggaattctggagcttaagctgaaagcactaatt
cttgatattattcataatattgatattgtgaagcaactaaaccaagttcaagttcataca
actgatgactgggcttggaagaaacaagtgagattctacatgaagagtgaccatacatgc
tatgttcaaatggtggactctgaactgcagtatacatacgagtaccagggtaacgcgccc
aagctggtttatactccactgacagacaaatgctacctgactctcactcaagccatgaag
atgggactcggagggaatccctatggacctgctgggactggaaaaactgagtcagtaaag
gcactaggtggacttcttgggagacaagttttagtttttaactgtgatgagggcattgat
gtgaagtcaatggggcggatatttgttgggttggtaaagtgtggggcctggggctgcttt
gatgagttcaatcgactggaagaagctgtcctgtcagccgtttccatgcagatccagacc
attcaggacgctttgaagaaccacagaactgtgtgtgagctgcttggaaaagaggtagaa
ataaatgccaattctggaatttttatcaccatgaatcctgctggaaaaggttatggagga
agacaaaaacttccagataaccttaaacagcttttcagaccagtggcgatgtcgcgtcca
gacaatgatctcatagcagaagtgattctatattcagagggcttcaaagatgctaaagaa
ttaggcaggaaattggtcgccattttcaacctatctagggaacttttgacacctcagcag
cattatgattgggggttgagagctttgaagacagttctgagaggaagtgggaatcttctg
agacagttgaagaaaaatagcacaaaacaagatgttaatgaaaatcacattgtggtgcaa
gcattgagacttaatacaatgtcaaaattcacatttgctgattgcacgcggtttgatgca
ctgattaaagatgtctttcctggcattgactttaaagaagtagaatacgacgaactaagt
tctgcattaaagcaagtctttgaggaggccaattatgaagtcatacccaatcagatgaag
aaggctctagaattatatgaacagttgcgccagagaacgggcgttgttattgttggtcca
agtggtgctggcaaatctaccctttggagaatgttaagggctgcactttgtaaaattggc
aaagtagtaaaacagtacactatgaatcccaaagctatgcccagacatcagctcttagga
cacattgacatggatacaagagagtggtcagatggcgttttgacaaatagtgctcgccaa
gtagttcgtgagcctcaagatgtcagctcatggataatctgtgatggtgacattgaccct
gaatggatagaatctctgaattctgttttggatgataatcggctgctcaccatgcctagt
ggagaaagaattcagtttggtccaaatgttaactttgtatttgaaactcatgatttaagt
tgtgcttcaccagccacaatatctagaatgggaatgatatttcttagtgatgaagagaca
gatcttaactctctcataaaatcttggttgaggaatcagcctcttgaatacagaagtaat
cttgaaaactggattggagattatttttcaaaagcgttacagtgggttttaaagcagaat
gactatgtggtggagacgagtctggttgggactgtgatgaatggcttgtcccacctccat
ggatgcaaataccatgaccagtttattattaatcttatacgaggactgggtggcaatctg
aatatgaaatcacgtctggagtttaccaaggaggtctttaattgggcacgggagacccct
ccagactctcacaggccaatggacacctactatgactgtgaccgaggacagttagcatcc
tacatgctaaagaagccagagagcctgacagctgatgatttcagcaatggccacatcctt
cctgtcattcagactcctgatatgcagcgaggtttagattatttcaaaccctggctaagt
tcagataccaaacagccatttattctggtgggaccagaaggatgtggcaaagggatgctg
ctcaggtatgccttctctcagctccgctccacagagattgccacaatccactgcagtgct
cagactacttctcggcatcttctgcaaaaactgagccagacttgcatggtaatcagtaca
aatactggtcgagtatacagaccaaaagattgtgaaagactcgttttgtatctaaaagat
atcaacctgcccaagcttgataagtgggggaccagcactttggtggctttcctccagcag
gtgttaacatatcaaggattttatgatgaaaatttggaatgggttggtctggagaatatt
cagattgtagcttccatgtcagctggaggaagactggggagacacaagctgaccaccagg
tttacgtctattgtccgtctttgtgccatagattacccagaaagagaacagttacagaca
atctatggagcatatttggaagcagttctgcacaaaaatctgaagaatcattctatttgg
ggttcttcgtcgaaaatttatctcttagcaggctctatggtgcaggtgtatgaacaggtg
cgggccaaattcacagtggatgaatacagccactacttcttcactccctgcattcttact
cagtgggtgcttggcttgttcagatatgatttagaaggaggatcctctaaccatccatta
gattacgtgctggaaattgtagcctatgaagcacggcgcttgtttcgggacaaaattgtt
ggtgtgaaggagctgcatttgtttgataacattttaacttcagtcctccaaggagactgg
ggctcagacatcctggacaatatggcagatagtttctatgttacatggggagcccaccat
gtctcaggaggaaagacagctccaggacagcctttacctccacacgggaaaccacttggc
aaactgacctctgcagacctgaaggatgtcattaagaagggtcttattcattatggacga
gataaccagaatttagatattttactcttccaagaagtcctggaatatatgtcgaggata
gacagagtgctgagtttccctggaggctcccttctgttggcaggacgaagcggcgtgggg
cggcggactgtcacatctttagtcagtcacatgcatggtgctgtgctcttctccccgaag
atctccaggggctacgagccgaagcagttcagaaatgatctcaagcatgtgctgcaactt
gcaggaattgaagcacagcaggtagtcttacttcttgaggattaccagtttgtacatccc
acattcttggagatgatcaatagccttttggcttcaggcgaggttcctggactgtatact
ctggaagaattagagcctttgctattgccactgaaagatcaagcttctcaggatggattt
tttggaccagtcttcaattacttcacatacagaattcaacaaaatttgcatattgtcttg
attatggattctgcaaatttgaacttcatagtaaactgtgagagtaatccagctttgcat
aagaaatgccaggtgctatggatggagggctggtcagacagcagtatgaaaaagatacca
gaaatgttattcagtgaaacagatggtgaagaaaaatatgaaaaaaaaagaaaggatgaa
aagaaaagaaattcagttgatcccgactttataaagtcattcttattaatccatgagtct
tgtaaagcttatggggccaccccaagcaggtacatgacctttctgcatgtgtattctgcc
atcagcagcagcaagaagaaggagttactgaaaagacagagtcatttacaggctggcgtg
tctaaactaaatgaagccaaagctcttgtagatgagctgaacagaaaggctggcgagcag
agtatcctgcttcgaataaagcaggatgaagcggactctgcccttcaggagatcacagtg
tccatgcaggatgctagtgaacaaaagacagaacttgaaagattgaaacagcgaatagca
gaagaagttgttaaaattgaagagagaaaaagtaaaattgatgatgaattaaaagaagta
caacctttagtcaatgaagctaagctagcagttggaaacattaggccggaatctctttca
gaaatccgctcactccgcatgccaccagatgtaatccgagacattcttgaaggagttttg
aggttaatgggtatctttgatacatcatgggtaagcatgaaaagcttccttgcaaaaagg
ggtgtgagagaagacattgcaacttttgatgcgcggaacattcctaaggagatacgagag
agtgtggaggagcttctcttcaaaaacaaagcctctttcgatccaaagaatgctaagcgt
gccagcactgcagctgctcctttggctgcttgggttaaggccaatgtacagtactcccat
gtcttggaacggattcagcctctggaaacagagcagtcaggattagaattgaatttgaag
aaaactgaagacagaaaaaggaagctagaagatcttctgaactctgttggtcagaaagta
tcagaactcaaagaaaaatttcagagcaggacgtcagaagctgccaaattggaagctgaa
gtcagcaaggcacaggagaccatcaaagctgcagaggtcctcattagtcagctagacaga
gagcacaggagatggaatgcccaggttgccgagatagctgaagaattagctaccctcccc
aaaagagctcagctagcggctgctttcatcacctacctctctgctgctccagaaggcctc
aggaaaaactgtctggaagagtggaccaaggcagctggtcttgagaaatttgatctcagg
cggtttctctgtactgaaagtgagcagttgatctggaaaagtgagggccttccatccgat
gacctttccattgagaatgcccttgtgatcttacagagtcgagtatgcccatttctgata
gatccatcttctcaggcaacagagtggctaaagacacatctgaaggactcacatttggaa
gttattaaccaacaggacagtaactttatcacagctcttgagttggcagtacgttttggg
aaaaccctcatcatacaagagatggacggggtagagcccgttctttatccgctgctgaga
cgagatctggttgctcaaggacctcggtatgtggtacaaataggtgacaagatcattgac
tacaatgaagatttccgccttttcttgtcaacaagaaatccaaatccctttatcccaccg
gatgccgcatccatcgtgactgaggtgaactttaccacaacaagaagtggacttcgagga
cagcttttagctttaaccattcagcatgaaaaacctgatctagaagaacagaaaacaaag
ctattacagcaggaagaagataagaaaatacagctggctagacttgaggagtctctctta
gagacacttgccacatctcaaggcaatattttggaaaacaaggatttgattgaatctttg
aatcagacaaaagcaagcagtgctcttattcaagactcacttaaggaatcgtataaactc
cagatttccctggatcaagagcgcgatgcctacttgcctctggctgagagtgccagcaag
atgtacttcatcatctcggatttgtccaagattaataacatgtaccgtttcagtttggct
tcatttctccgactttttcagcgagctctccagaacaagcaggactctgaaaatacagaa
gaaagaatccaatgtcttgtgaactcactgaaacacatggtttatgaatatatatgcagg
tgcctgtttaaggcggaccagttgatgtttgctttgcattttgttcgaggaatgcatcct
gaactttttcaagaaaatgaatgggatacattcacaggtgtggttgttggagacatgctg
cgcaaagctgactctcaacaaagaattcgtgatcagcttccatcttggatagatcaagaa
aggagctgggcagtggcaacattgaagatctccctccctagtctctaccagactctctgt
ttggaagatggggcattttggcgtacttactatcatcactcaatgtgtgaacaggagttt
ccatcaattcttgcaaagaaggtttccttatttcagcaggttcttgtagttcaggctctg
cggccagacagactacagagtgccatggctctgtttgcctgcaaggctctggggttgaag
gagttatcccctcttcctctgaacctcaaacgcttatacaaggagaccctcgagattgaa
cccattttgatcataatctctccaggggctgacccttctcaggaacttcaggaacttgct
agtgctgaaagaagcagtgagtgttatcaccaggttgccatgggtcaaggtcaagctgat
ttagcaattcagatgctaaaagaatgtgcccgaaatggagattggctctgtttgaagaac
ttacatcttgtggtgtcttggcttccagttctggagaaggaattgaatactcttcagcct
aaagacagctttcgtctgtggctcactgcagaagttcatcccaactttacccccatatta
ctccaatcaagtctgaagataacatatgagtcacctccaggtttgaagaagaatttgatg
cgcacttatgagtcttggactcctgagcaaattagcaaaagagataacatacaccgagct
catgctctttttagcttagcatggtttcatgctgcctgtcaggaaagaagaaattatatt
ccacagggttggaccaagttttatgagttttccttatcagatcttcgggccgggtaccat
gtcattgacaggctcttcgatggtaccaaagatgtacagtgggaatttgtacacggctta
cttgaaaattctatttatggaggacgtgtagataactattttgatcttagagttcttcag
tcctacttgaagcagttttttaattcttcaataattgatgtactaaaccaaaggaacaag
aaaagcatttttccatattccatctctctcccaaactcgtgcagcattttggactaccgt
gctgtcatcgagaagctccccgaggacgataagcccagcttcttcggtctgcccgccaac
attgcccgctcctctcagcgcatgatcagctctcaggtcatctcccagctcaggatcttg
ggaagatcggtcacagccggttgcaaatttgacagagaaatctggtctaatgaactttct
ccagttctgaatctttggaaaaagctgaaccagaattcaaacctaattcatcaaaaagta
tcaccacctaatgatcgacaaggatctccaatattatcgttcatcattcttgagcagttc
aatgccatccgcttggtacaaagtgttcatcagtcgcttgctgccctcagcaaagtcatc
aggggaactactttactgagttcagaagtacaaaagctggcaagtgctttattaaaccag
aagtgtcctctcacatggcagagcaggtgggaaggtcctgaggatcctctccagtacctt
cgtggcctcgtagccagaacccttgcaattcagaattgggtagagaaagctgaaaagcaa
gttcttctcgctgatacacttgacctatctgagctcttccatccggacacattccttaat
gctcttcgccaggaaactgcaagggcaacaggctgctctgtggatagtcttaaatttgta
gcatcctggaaaggccgacttcaagaagcaaagctgcaaattaagatcagtggcctgtta
ctggaagggtgcagttttgatggcaatcgcctttcagagaaccagcatgattctcctagc
gtatcgtcagttcttccttgctacatgggctggactccacaaggttcatatggtccatat
tcccctgatgagtgcatctctttgcctgtttatacaagtgctgagagggagcgtgtggtg
accaacattgatgttccctgtggtggtaaccaggaccagtggatccagtgtggggcagcg
ctgtttcttaaaaatcagtag

DBGET integrated database retrieval system