KEGG   Mus musculus (house mouse): 112415
Entry
112415            CDS       T01002                                 
Symbol
Zfp607b, C030039L03Rik
Name
(RefSeq) zinc finger protein 607B
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112415 (Zfp607b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    112415 (Zfp607b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    112415 (Zfp607b)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB Zn-ribbon_8 zf-C2H2_jaz Zn_Tnp_IS1595 zf-met zf-C2H2_11 HVO_2753_ZBP
Other DBs
NCBI-GeneID: 112415
NCBI-ProteinID: NP_001106202
MGI: 2148237
Ensembl: ENSMUSG00000057093
UniProt: G3X9H3 Q6P9L8 Q3URA4
Position
7:27374086..27405909
AA seq 648 aa
MASSSSQHMVCGSVTFRDVAVDFSQEEWACLDATQKVLYRNIMLETYSNLVAVVGRCISK
PDLIVLLEQEKEPWMAVKEETDRPSPDVETCVEAENISPENHMSDVNLHKQSIRQFSKTF
DLKESTFSDGPSCSTFKGLQGYQGDADERVTKKERVPPCTCQTLAHNTEKAYECKECGTC
FDCSSALTQHQSVHAGEKLYECKECGKAFRLPQELTRHQKSHSGEKPFQCNECGKAFHLP
DLLKYHKVIHTGEKPFECEVCGKFFSRVSSLAEHRIVHADVKPYECSECGKAFKRRSDLM
QHQKIHSGERPFQCKDCGKAFIVLAQLAQHQSIHTGEKLECKHCGKIFSSGFYLVRHQSI
HTGEKPFGCHVCGKAFRLQVYLNEHQKTHTDEKPFKCKLCGSAFRRKYQLSEHQKIHTNV
KPYQCKECGKSFRRRSNFTEHQSIHTGKKPFECKDCGKVFRLNIHLIRHQRFHSGKTPFE
CNECGKGFHFSSQLNYHKTIHTGQTPFECKECGKSFKRICSLLEHGVIHAAVKPFECSEC
GKTFNRRSNLIQHQKIHSDERPFECKDCGKAFTVLAQLTRHHTIHTGKKSYECEQCGSAF
RLPYQLTQHQRIHDDVKPFQCKECGKGFVRGTALRIHQRVHTGEALPV
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggccagctccagttctcaacacatggtctgtgggtcagtgacatttagggatgtggct
gttgacttctctcaggaggagtgggcctgcctggatgctactcagaaggtgttatacagg
aacataatgttggagacctacagcaacctggtcgcagtggtgggacgttgtatttccaag
ccagatctgatcgtcttactagagcaggagaaagagccctggatggctgtgaaggaagaa
acagacaggccgagcccagatgtggagacatgtgttgaagctgaaaatatatctccggag
aatcatatgtctgatgtaaatttacacaaacagagcataaggcaattcagtaaaactttt
gaccttaaagagtctacttttagtgatggccccagctgtagtacattcaaaggactacag
ggttatcaaggagatgctgatgaaagggttactaagaaggaaagagtgcctccttgtacc
tgccagactcttgctcacaatacagaaaaggcatatgagtgtaaagagtgtgggacgtgc
ttcgattgtagttcagctcttactcagcatcagagtgttcatgctggagagaagctctat
gaatgtaaggagtgtgggaaggccttcagactcccccaagagctcacaaggcatcagaag
tctcacagtggtgagaaacctttccagtgtaatgaatgtggaaaggcttttcatcttccc
gacctgctgaaatatcataaagtcattcatacaggtgaaaagccttttgaatgtgaagta
tgtgggaagttcttcagccgtgtctccagccttgctgaacataggattgtccatgctgat
gtgaaaccctatgagtgtagtgagtgtgggaaagcctttaaacgtcgctcagacctaatg
caacatcagaaaatccattctggtgagagaccctttcagtgtaaggactgtgggaaggcc
ttcattgttctggcacagctcgctcagcaccagagcattcacactggagagaaattggaa
tgtaagcattgtgggaagatatttagtagtggtttttaccttgtacgacaccagagtatt
cacactggtgagaaaccctttgggtgtcatgtctgtggcaaggcttttaggcttcaggta
taccttaatgagcatcagaaaactcacaccgatgagaaacctttcaagtgtaagctgtgt
gggtcagcctttagacgtaaataccagctcagtgaacatcagaaaatccataccaatgtg
aaaccgtatcagtgcaaagaatgtgggaaatcctttcgtcgacgatcaaattttactgag
catcagagtattcacactggaaagaaaccctttgaatgtaaggactgtgggaaggtcttt
agactaaatatacatctcattcgacaccagagatttcatagtggtaagacaccttttgaa
tgtaatgaatgtggaaagggctttcatttttccagccagcttaattaccataaaaccatt
catacaggtcagacaccttttgaatgtaaagaatgtgggaagtctttcaagcgcatctgc
agccttttggaacatggggttattcatgctgctgtgaaaccatttgaatgtagtgagtgt
gggaaaacctttaatcgtcgctcaaacctcatacaacatcagaaaattcattctgatgag
agaccctttgagtgtaaggactgtgggaaggccttcactgttctggctcagctcacacga
caccacactattcatactggaaagaaatcatatgaatgtgagcagtgtgggtcagccttc
agactcccgtaccaactcactcaacatcagagaattcatgatgatgtgaaaccatttcag
tgcaaggaatgtggaaagggctttgttcgtggtacagctcttagaatccaccaaagagtc
catactggtgaggcccttccagtgtga

DBGET integrated database retrieval system