KEGG   Mus musculus (mouse): 11287
Entry
11287             CDS       T01002                                 

Symbol
Pzp, A1m, A2m, AI893533, MAM
Name
(RefSeq) PZP, alpha-2-macroglobulin like
  KO
K23589  pregnancy zone protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    11287 (Pzp)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   11287 (Pzp)
SSDB
Motif
Pfam: TED_complement A2M_BRD A2M A2M_recep MG3 MG4 MG2 SVA Big_1 Prenyltrans
Other DBs
NCBI-GeneID: 11287
NCBI-ProteinID: NP_031402
MGI: 87854
Ensembl: ENSMUSG00000030359
Vega: OTTMUSG00000022212
Position
6 F3; 6 63.02 cM
AA seq 1495 aa
MRRNQLPTPAFLLLFLLLPRDATTATAKPQYVVLVPSEVYSGVPEKACVSLNHVNETVML
SLTLEYAMQQTKLLTDQAVDKDSFYCSPFTISGSPLPYTFITVEIKGPTQRFIKKKSIQI
IKAESPVFVQTDKPIYKPGQIVKFRVVSVDISFRPLNETFPVVYIETPKRNRIFQWQNIH
LAGGLHQLSFPLSVEPALGIYKVVVQKDSGKKIEHSFEVKEYVLPKFEVIIKMQKTMAFL
EEELPITACGVYTYGKPVPGLVTLRVCRKYSRYRSTCHNQNSMSICEEFSQQADDKGCFR
QVVKTKVFQLRQKGHDMKIEVEAKIKEEGTGIELTGIGSCEIANALSKLKFTKVNTNYRP
GLPFSGQVLLVDEKGKPIPNKNITSVVSPLGYLSIFTTDEHGLANISIDTSNFTAPFLRV
VVTYKQNHVCYDNWWLDEFHTQADHSATLVFSPSQSYIQLELVFGTLACGQTQEIRIHYL
LNEDIMKNEKDLTFYYLIKARGSIFNLGSHVLSLEQGNMKGVFSLPIQVEPGMAPEAQLL
IYAILPNEELVADAQNFEIEKCFANKVNLSFPSAQSLPASDTHLKVKAAPLSLCALTAVD
QSVLLLKPEAKLSPQSIYNLLPGKTVQGAFFGVPVYKDHENCISGEDITHNGIVYTPKHS
LGDNDAHSIFQSVGINIFTNSKIHKPRFCQEFQHYPAMGGVAPQALAVAASGPGSSFRAM
GVPMMGLDYSDEINQVVEVRETVRKYFPETWIWDLVPLDVSGDGELAVKVPDTITEWKAS
AFCLSGTTGLGLSSTISLQAFQPFFLELTLPYSVVRGEAFTLKATVLNYMSHCIQIRVDL
EISPDFLAVPVGGHENSHCICGNERKTVSWAVTPKSLGEVNFTATAEALQSPELCGNKLT
EVPALVHKDTVVKSVIVEPEGIEKEQTYNTLLCPQDTELQDNWSLELPPNVVEGSARATH
SVLGDILGSAMQNLQNLLQMPYGCGEQNMVLFVPNIYVLNYLNETQQLTEAIKSKAINYL
ISGYQRQLNYQHSDGSYSTFGNHGGGNTPGNTWLTAFVLKAFAQAQSHIFIEKTHITNAF
NWLSMKQKENGCFQQSGYLLNNAMKGGVDDEVTLSAYITIALLEMPLPVTHSAVRNALFC
LETAWASISQSQESHVYTKALLAYAFALAGNKAKRSELLESLNKDAVKEEDSLHWQRPGD
VQKVKALSFYQPRAPSAEVEMTAYVLLAYLTSESSRPTRDLSSSDLSTASKIVKWISKQQ
NSHGGFSSTQDTVVALQALSKYGAATFTRSQKEVLVTIESSGTFSKTFHVNSGNRLLLQE
VRLPDLPGNYVTKGSGSGCVYLQTSLKYNILPVADGKAPFALQVNTLPLNFDKAGDHRTF
QIRINVSYTGERPSSNMVIVDVKMVSGFIPMKPSVKKLQDQPNIQRTEVNTNHVLIYIEK
LTNQTLGFSFAVEQDIPVKNLKPAPIKVYDYYETDEFTVEEYSAPFSDGSEQGNA
NT seq 4488 nt   +upstreamnt  +downstreamnt
atgaggagaaaccagctgcccacaccagcttttcttttactgttcctgcttcttcccaga
gatgccaccacagctactgcaaaaccacaatatgtggtgctggtcccgtcagaggtctat
tcaggagtccctgaaaaggcctgtgtcagcctcaaccatgtgaatgagactgtgatgctc
agcttaactctagagtatgcaatgcagcaaacgaagctcctcacagaccaggctgtggat
aaggactccttctactgcagccccttcacgatctcaggttcacctttaccctacacattc
attactgtggagataaaaggaccaacgcagcgcttcataaagaagaagtcaatacaaata
ataaaagctgagagcccagtctttgtccagacagacaaacccatatacaaaccaggacag
atagtgaaattccgagttgtttctgtggacatcagttttcgcccgttgaatgaaacgttc
cctgtcgtttatattgagactcccaagaggaaccgaatttttcaatggcaaaatatccat
ctggcaggaggactccaccagctctctttcccactgtctgttgagccagctctgggtatc
tacaaggttgtagtgcagaaggactcagggaagaaaatagaacactcctttgaggtgaag
gaatacgttttacccaaatttgaggtgataataaaaatgcagaagactatggctttcctg
gaagaggaacttcctataactgcttgtggcgtatacacatatggaaagcctgttcccggt
ctggtgacattgagagtgtgcagaaaatattcacgataccgctccacctgccataaccaa
aactcaatgagtatctgtgaagaattcagccaacaggcagatgataaaggatgtttcaga
caagttgtaaaaaccaaagtattccagctcagacaaaaaggccacgacatgaagatagag
gtggaagccaaaatcaaagaggaaggaacaggaatagaactaactggtattggatcatgt
gaaatagcaaatgccttaagcaaactgaaatttactaaagtaaatacaaattacaggcct
gggctacctttctctggacaggttcttcttgttgatgagaagggtaaaccaatccccaac
aaaaacataacttccgtcgtgtctccacttgggtacctgtccatttttactacggatgag
catggcttggctaacatttccattgacacttccaacttcacagctccgtttttgagagtt
gtggtcacctacaagcagaaccatgtctgctatgataactggtggcttgatgaatttcac
acacaggcagaccattctgcaactctagtcttttctccaagccagagttatattcaactt
gaacttgtttttggtactttggcctgtgggcaaactcaggagattcggatacactacctc
ttgaatgaagatatcatgaagaatgaaaaagacttaaccttttactatctgatcaaagca
aggggaagcatcttcaacttaggaagccatgtgttgtcgcttgaacaaggaaacatgaaa
ggagtcttttccctcccaattcaagtggagccaggcatggctcccgaggctcagctgctc
atttatgctattttacctaatgaagaacttgtcgctgatgctcagaattttgaaatcgag
aagtgttttgccaacaaggtaaatttgagtttcccatcagcacagagcctgccagcctct
gacacccacctgaaggtcaaagccgcgcctctgtccctctgtgccctcactgcagtagac
cagagtgtgctgctactgaagcccgaagccaagctctcacctcagtcaatctacaatttg
ctgccaggaaagactgtccagggtgccttctttggtgtcccagtgtacaaagaccatgag
aactgcatcagcggagaagacatcactcacaatgggatcgtgtacacgccaaagcactct
ctgggcgataatgatgcacacagcatttttcagtctgtaggaataaatatttttaccaac
tccaaaatccacaaaccacgcttttgtcaagagtttcaacactatccggcaatgggagga
gtggcacctcaagccttagctgtggctgcttcaggcccaggatccagcttcagagcaatg
ggcgtgccgatgatggggttggactactctgatgaaattaatcaggtggtggaagtaaga
gagacagtgcggaagtacttccctgagacctggatctgggacctggtgccactggacgta
tccggggacggtgaattggcggtaaaggtccccgacaccatcactgagtggaaggccagt
gcattctgcttgtctggaaccactggccttggcctctcctccaccatctcccttcaagcc
ttccagcccttcttcttggagctcactctcccatactctgtggtgcgaggggaagccttt
accctcaaagccaccgtgctcaattacatgtctcactgcattcagatccgagtggaccta
gagatttctcctgatttcctggcagtcccagtggggggccatgaaaactctcattgcatc
tgtggaaatgaaaggaaaaccgtgtcctgggctgtgaccccaaagtcgctgggggaggtg
aacttcacagctaccgcagaagccttgcagtctccagaattgtgtggcaataagttgaca
gaagtgccagcccttgtacacaaggacactgtggtgaagtccgtaatagttgagcctgaa
ggaattgagaaggagcaaacgtacaacacactgttatgcccacaagatactgagttacaa
gataattggtcactggagcttccacccaatgtggttgaaggatctgccagggctacacat
tccgttttgggtgatatactgggctctgcaatgcaaaacctccagaatcttctccagatg
ccctatggctgtggggaacaaaacatggtcctttttgtccctaacatctatgttctgaac
tatctgaacgagacacagcagctgacagaggcgatcaagtccaaagccattaactacctc
atcagtgggtaccagaggcagctgaactatcagcacagtgatggctcgtacagcacattc
gggaaccatggtggtggcaacactccgggaaatacttggctcactgcgtttgtgctcaag
gcctttgctcaagctcagtcgcacatctttatagagaagacacacatcacaaatgctttc
aactggctctccatgaaacaaaaggagaatggctgtttccaacagtctggatatctgctt
aacaatgcgatgaagggtggtgtggatgatgaagtgactctctctgcctacatcaccatt
gctctgctggagatgcctctgcctgtcacgcacagtgctgtgcgaaatgctctattttgc
ctggaaacggcctgggcctccatctcacagagccaggaaagtcatgtctataccaaggca
ttgctggcctatgccttcgccctggcaggaaacaaggccaagagaagcgaactgcttgaa
tccctaaacaaagatgctgtgaaggaagaggattcgctgcactggcaacgccctggggat
gttcagaaagtgaaggccttatctttctatcaacctcgggccccttctgccgaagtggag
atgacagcttacgtgcttctcgcctatctaacctctgagtcttcccggcccacacgggac
ctgtcttcatcagacctgtccacagcatccaagattgtgaagtggatcagcaagcaacaa
aactcccacgggggcttctcctccactcaggatacagtggtggctctccaagccctctcc
aaatatggagctgccacttttacgagaagtcagaaagaagtgttggtcaccatcgagtct
tcagggaccttctctaagactttccatgttaacagtggcaatcgcctgctgctgcaggaa
gtcaggctgccagatctgcccggaaattacgtcaccaaagggtcaggatcaggatgtgtg
taccttcagacatctctaaagtacaacatcctcccagtggcagatggaaaagcacccttc
gctctgcaagtcaacactctccccctaaactttgacaaggcaggagatcacagaacattc
cagattcgcatcaacgtaagctacactggagaacgacccagctccaacatggtcattgtt
gatgtgaagatggtatcaggcttcatacctatgaagccatccgtgaaaaagctccaagac
cagcctaacattcagaggactgaagtgaacaccaaccatgttctaatctacattgaaaag
ctaaccaatcaaaccctcggtttctccttcgcggtggaacaagacatcccagtaaagaac
ttaaaaccagcccccataaaagtctatgattattatgagacagatgaattcaccgttgaa
gaatacagtgcccctttcagtgatggctctgaacaaggaaatgcttaa

DBGET integrated database retrieval system