KEGG   Mus musculus (mouse): 11352Help
Entry
11352             CDS       T01002                                 

Gene name
Abl2, AA536808, Abll, Arg
Definition
(RefSeq) v-abl Abelson murine leukemia viral oncogene 2 (arg, Abelson-related gene)
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11352 (Abl2)
   04012 ErbB signaling pathway
    11352 (Abl2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    11352 (Abl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11352 (Abl2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     11352 (Abl2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  ABL family
   11352 (Abl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SH3_6
Motif
Other DBs
NCBI-GeneID: 11352
NCBI-ProteinID: NP_001129576
MGI: 87860
Ensembl: ENSMUSG00000026596
Vega: OTTMUSG00000037114
UniProt: B2RQ57
Structure
PDB: 

Position
1 G3; 1 67.71 cM
AA seq 1078 aa AA seqDB search
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTADAGFNVFTQHDHFASCVE
DGFEGDKTGGSSPEVLHRPFGCDAESQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDSKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRTASSSSVVPYLPRLPLLPSKTRTLRKQGENKENLDGGLDAAE
SLASSSAPAGFIRSTQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKK
RNAPTPPKRSSSFREMENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQP
EENVDRANDMLPKKSEEGAAPARERPKAKLLPRGATALPLRAPDPAITESDSPGVGVAGV
AAAPKGKERNGGTRLGVAGVPEDGEQLGWSSPAKAVAVLPTTHNHKVPVLISPTLKHTPA
DVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSTCSDPEE
EPTAPPAGQHTPETQEGGKKAAPGPMPSSGKPGRPVMPPPQVPLPTSSISPAKMANGTAG
TKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYV
DSIPQTRNKFAFREAVSKLELSLQELQVSSTAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaggctccggggctccagcagccgcagccgcgc
gggatccggggcagcagcgcagccaggccctcgggccgcaggcgggacccggcggggcgt
accgcagacgccggcttcaacgtcttcacccagcacgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagttttgcaccgcccgttt
ggctgtgatgctgaatctcaggcactgaatgaagcgatcaggtggagctccaaggagaac
ttgctgggagccactgagagtgaccctaatctctttgttgcactttatgactttgtggca
agtggtgataacacactcagtatcactaaaggtgaaaagctgcgagtccttggttataac
cagaatggcgagtggagtgaagttcgctccaagaatggacagggttgggtgccaagcaac
tacatcactccagttaatagcctggagaaacattcctggtaccacggacctgtatcccgc
agcgcagcagagtatctcctcagcagcctaatcaatggcagcttcctggttcgagagagt
gagagcagccctgggcagctgtccatctctctcaggtatgagggacgtgtgtatcactac
aggatcaataccaccacagacagcaaggtgtacgtgacagctgagagccgctttagcacc
ttggcagagcttgttcaccaccactccacagttgctgatgggctagtgaccacgctgcac
tacccagcaccgaagtgcaacaagccaaccgtctatggcgtgtctcctatccatgacaag
tgggaaatggaacggacagatatcaccatgaagcacaaacttgggggcggtcagtacgga
gaggtttacgttggcgtctggaagaagtacagccttacagtggctgtgaaaacactgaag
gaagacaccatggaggtggaggagttcctgaaggaagctgcagtgatgaaggagatcaag
catcctaacttagtacaactgctaggtgtgtgtaccctggagccaccgttttacattgtg
actgaatacatgccgtatgggaacctgcttgactatctccgggagtgcagccgagaggag
gtgaccgccgtcgtgttactttacatggccacccagatctcctctgccatggagtacttg
gagaagaagaacttcatccatagagatcttgctgcccggaactgcctagtgggcgagaac
catgtggtgaaagtggccgactttggtttaagtagactgatgactggagatacctacact
gctcatgctggagccaaatttcctattaaatggacagcacccgagagtctggcctacaat
accttttcaattaaatctgacgtttgggcgtttggagtactgttgtgggaaattgctaca
tatggaatgtcaccatatccaggtattgacctatctcaagtctatgacctactggaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaagtgtatgaacttatgagagca
tgctggaagtggagccctgctgacaggccctcttttgctgaaacccatcaagcttttgaa
acaatgttccatgactccagcatctctgaagaggtagctgaggagcttgggagaacggcc
tcctcctcctctgtggttccatacctgcctcggttaccgctgcttccttccaagacgagg
accctgaggaagcagggggagaacaaagagaacctagatgggggccttgatgccgccgag
agcctggcctccagctcagcaccagcagggttcattagaagcacacaggcctccagtggg
tccccagctctgcctcgaaagcaaagagataagtcgcccagcagcctcttagaagatgcc
aaagagacatgctttaccagggataggaaggggggcttcttcagctccttcatgaaaaag
aggaacgcccccacgcccccgaagcgcagcagctcctttcgagaaatggagaatcagccc
cacaagaaatatgaactcacggggcttccagagcaggataggatggcaatgacccttccc
aggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttctcaacca
gaagagaatgtggacagggctaatgacatgcttccaaaaaaatctgaggaaggtgctgct
ccagccagggagagaccaaaagccaaactattgcccagaggagccacagctcttcccttg
agagcccctgatccagccatcacagagagtgactctccgggggtaggggtggctggagtg
gcagctgcccccaaaggcaaggaaaggaatggtgggacgcgacttggagtcgctggagtc
cccgaggatggagagcagctaggctggtcttctccagccaaggctgtagctgtcctccca
accactcacaaccacaaagtgccagtccttatctctcccactctgaaacacactccagct
gatgtgcagctcattggcacagactctcaggggaacaaattcaagctcttatctgagcat
caggtcacatcctctggagacaaggaccgaccccgtcgggtaaaaccaaagtgtgcccca
ccccccccaccagtgatgagactactgcagcatccgtccacatgctcagaccccgaggaa
gagccgactgccccacctgcaggacagcacactccagagacccaggagggaggaaaaaag
gcagctccaggcccaatgcccagtagtgggaaacctgggaggccagtcatgcctccacct
caagtgcctttgcccacatcttccatctcaccggccaaaatggccaatggcacagcaggt
actaaggtggccctgaggaaaaccaaacaggcagctgagaaaatctcagctgacaaaatc
agcaaagaggccctgctggagtgtgccgacctactgtccagtgcaatcacggaacctgtg
cccaacagccaactggtggacactgggcaccagctgctcgactactgctcagggtatgtg
gacagcatccctcagactcgcaacaagtttgccttccgagaggctgtgagcaaactggaa
cttagcttacaggagctgcaggtgtcttccacagctgctggtgtgcctgggacaaacccc
gtccttaataacttattgtcgtgtgtacaggaaattagcgatgtggtgcagaggtag

DBGET integrated database retrieval system