KEGG   Mus musculus (house mouse): 11352
Entry
11352             CDS       T01002                                 
Symbol
Abl2, Abll, Arg
Name
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu05208  Chemical carcinogenesis - reactive oxygen species
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    11352 (Abl2)
   04014 Ras signaling pathway
    11352 (Abl2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    11352 (Abl2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    11352 (Abl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11352 (Abl2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     11352 (Abl2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  ABL family
   11352 (Abl2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase SH3_6 ABC1 Kinase-like RGS12_us1
Other DBs
NCBI-GeneID: 11352
NCBI-ProteinID: NP_001129576
MGI: 87860
Ensembl: ENSMUSG00000026596
UniProt: B2RQ57
Position
1:156386160..156477189
AA seq 1078 aa
MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTADAGFNVFTQHDHFASCVE
DGFEGDKTGGSSPEVLHRPFGCDAESQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDSKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRTASSSSVVPYLPRLPLLPSKTRTLRKQGENKENLDGGLDAAE
SLASSSAPAGFIRSTQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKK
RNAPTPPKRSSSFREMENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQP
EENVDRANDMLPKKSEEGAAPARERPKAKLLPRGATALPLRAPDPAITESDSPGVGVAGV
AAAPKGKERNGGTRLGVAGVPEDGEQLGWSSPAKAVAVLPTTHNHKVPVLISPTLKHTPA
DVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSTCSDPEE
EPTAPPAGQHTPETQEGGKKAAPGPMPSSGKPGRPVMPPPQVPLPTSSISPAKMANGTAG
TKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGYV
DSIPQTRNKFAFREAVSKLELSLQELQVSSTAAGVPGTNPVLNNLLSCVQEISDVVQR
NT seq 3237 nt   +upstreamnt  +downstreamnt
atggggcagcaggtgggccgcgtcggggaggctccggggctccagcagccgcagccgcgc
gggatccggggcagcagcgcagccaggccctcgggccgcaggcgggacccggcggggcgt
accgcagacgccggcttcaacgtcttcacccagcacgatcactttgccagctgtgtggag
gatggatttgagggagacaagactggaggcagtagtccagaagttttgcaccgcccgttt
ggctgtgatgctgaatctcaggcactgaatgaagcgatcaggtggagctccaaggagaac
ttgctgggagccactgagagtgaccctaatctctttgttgcactttatgactttgtggca
agtggtgataacacactcagtatcactaaaggtgaaaagctgcgagtccttggttataac
cagaatggcgagtggagtgaagttcgctccaagaatggacagggttgggtgccaagcaac
tacatcactccagttaatagcctggagaaacattcctggtaccacggacctgtatcccgc
agcgcagcagagtatctcctcagcagcctaatcaatggcagcttcctggttcgagagagt
gagagcagccctgggcagctgtccatctctctcaggtatgagggacgtgtgtatcactac
aggatcaataccaccacagacagcaaggtgtacgtgacagctgagagccgctttagcacc
ttggcagagcttgttcaccaccactccacagttgctgatgggctagtgaccacgctgcac
tacccagcaccgaagtgcaacaagccaaccgtctatggcgtgtctcctatccatgacaag
tgggaaatggaacggacagatatcaccatgaagcacaaacttgggggcggtcagtacgga
gaggtttacgttggcgtctggaagaagtacagccttacagtggctgtgaaaacactgaag
gaagacaccatggaggtggaggagttcctgaaggaagctgcagtgatgaaggagatcaag
catcctaacttagtacaactgctaggtgtgtgtaccctggagccaccgttttacattgtg
actgaatacatgccgtatgggaacctgcttgactatctccgggagtgcagccgagaggag
gtgaccgccgtcgtgttactttacatggccacccagatctcctctgccatggagtacttg
gagaagaagaacttcatccatagagatcttgctgcccggaactgcctagtgggcgagaac
catgtggtgaaagtggccgactttggtttaagtagactgatgactggagatacctacact
gctcatgctggagccaaatttcctattaaatggacagcacccgagagtctggcctacaat
accttttcaattaaatctgacgtttgggcgtttggagtactgttgtgggaaattgctaca
tatggaatgtcaccatatccaggtattgacctatctcaagtctatgacctactggaaaaa
ggatatcgaatggaacagcctgagggatgcccccctaaagtgtatgaacttatgagagca
tgctggaagtggagccctgctgacaggccctcttttgctgaaacccatcaagcttttgaa
acaatgttccatgactccagcatctctgaagaggtagctgaggagcttgggagaacggcc
tcctcctcctctgtggttccatacctgcctcggttaccgctgcttccttccaagacgagg
accctgaggaagcagggggagaacaaagagaacctagatgggggccttgatgccgccgag
agcctggcctccagctcagcaccagcagggttcattagaagcacacaggcctccagtggg
tccccagctctgcctcgaaagcaaagagataagtcgcccagcagcctcttagaagatgcc
aaagagacatgctttaccagggataggaaggggggcttcttcagctccttcatgaaaaag
aggaacgcccccacgcccccgaagcgcagcagctcctttcgagaaatggagaatcagccc
cacaagaaatatgaactcacggggcttccagagcaggataggatggcaatgacccttccc
aggaactgccagaggtccaaactccagctggaaaggacagtgtccacctcttctcaacca
gaagagaatgtggacagggctaatgacatgcttccaaaaaaatctgaggaaggtgctgct
ccagccagggagagaccaaaagccaaactattgcccagaggagccacagctcttcccttg
agagcccctgatccagccatcacagagagtgactctccgggggtaggggtggctggagtg
gcagctgcccccaaaggcaaggaaaggaatggtgggacgcgacttggagtcgctggagtc
cccgaggatggagagcagctaggctggtcttctccagccaaggctgtagctgtcctccca
accactcacaaccacaaagtgccagtccttatctctcccactctgaaacacactccagct
gatgtgcagctcattggcacagactctcaggggaacaaattcaagctcttatctgagcat
caggtcacatcctctggagacaaggaccgaccccgtcgggtaaaaccaaagtgtgcccca
ccccccccaccagtgatgagactactgcagcatccgtccacatgctcagaccccgaggaa
gagccgactgccccacctgcaggacagcacactccagagacccaggagggaggaaaaaag
gcagctccaggcccaatgcccagtagtgggaaacctgggaggccagtcatgcctccacct
caagtgcctttgcccacatcttccatctcaccggccaaaatggccaatggcacagcaggt
actaaggtggccctgaggaaaaccaaacaggcagctgagaaaatctcagctgacaaaatc
agcaaagaggccctgctggagtgtgccgacctactgtccagtgcaatcacggaacctgtg
cccaacagccaactggtggacactgggcaccagctgctcgactactgctcagggtatgtg
gacagcatccctcagactcgcaacaagtttgccttccgagaggctgtgagcaaactggaa
cttagcttacaggagctgcaggtgtcttccacagctgctggtgtgcctgggacaaacccc
gtccttaataacttattgtcgtgtgtacaggaaattagcgatgtggtgcagaggtag

DBGET integrated database retrieval system