KEGG   Mus musculus (mouse): 11622Help
Entry
11622             CDS       T01002                                 

Gene name
Ahr, Ah, Ahh, Ahre, In, bHLHe76
Definition
(RefSeq) aryl-hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04659  Th17 cell differentiation
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    11622 (Ahr)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    11622 (Ahr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11622 (Ahr)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    11622 (Ahr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4 PAS_9
Motif
Other DBs
NCBI-GeneID: 11622
NCBI-ProteinID: NP_038492
MGI: 105043
Ensembl: ENSMUSG00000019256
Vega: OTTMUSG00000036999
UniProt: P30561 Q3U5D9
Structure
PDB: 

Position
12 A3; 12 15.78 cM
AA seq 805 aa AA seqDB search
MSSGANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVI
NKLDKLSVLRLSVSYLRAKSFFDVALKSTPADRNGGQDQCRAQIRDWQDLQEGEFLLQAL
NGFVLVVTADALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPDS
AQGVDEAHGPPQAAVYYTPDQLPPENASFMERCFRCRLRCLLDNSSGFLAMNFQGRLKYL
HGQNKKGKDGALLPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGQL
ILGYTEVELCTRGSGYQFIHAADILHCAESHIRMIKTGESGMTVFRLLAKHSRWRWVQSN
ARLIYRNGRPDYIIATQRPLTDEEGREHLQKRSTSLPFMFATGEAVLYEISSPFSPIMDP
LPIRTKSNTSRKDWAPQSTPSKDSFHPSSLMSALIQQDESIYLCPPSSPALLDSHFLMGS
VSKCGSWQDSFAAAGSEAALKHEQIGHAQDVNLALSGGPSELFPDNKNNDLYSIMRNLGI
DFEDIRSMQNEEFFRTDSTAAGEVDFKDIDITDEILTYVQDSLNNSTLLNSACQQQPVTQ
HLSCMLQERLQLEQQQQLQQPPPQALEPQQQLCQMVCPQQDLGPKHTQINGTFASWNPTP
PVSFNCPQQELKHYQLFSSLQGTAQEFPYKPEVDSVPYTQNFAPCNQPLLPEHSKSVQLD
FPGRDFEPSLHPTTSNLDFVSCLQVPENQSHGINSQSAMVSPQAYYAGAMSMYQCQPGPQ
RTPVDQTQYSSEIPGSQAFLSKVQS
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcggcgccaacatcacctatgccagccgcaagcggcgcaagccggtgcagaaa
acagtaaagcccatccccgctgaaggaattaagtcaaatccttctaagcgacacagagac
cggctgaacacagagttagaccgcctggccagcctgctgcccttcccgcaagatgttatt
aataagctggacaaactctctgttcttaggctcagcgtcagctacctgagggccaagagc
ttctttgatgttgcattaaagtccacccctgctgacagaaatggaggccaggaccagtgt
agagcacaaatcagagactggcaggatttgcaagaaggagagttcttgttacaggcgctg
aatggctttgtgctggttgtcacagcagatgccttggtcttctatgcttcctccactatc
caagattacctgggctttcagcagtctgatgtcatccatcagagcgtatatgagctcatc
catacagaagaccgggcggaattccagcgccagcttcactgggctctaaacccagactct
gcacaaggagtggacgaagcccatggccctccacaggcagcagtctattataccccagac
cagcttcctccagagaacgcttctttcatggagaggtgcttcaggtgccggctgaggtgc
ctgctggataattcatctggttttctggcaatgaatttccaagggaggttaaagtatctt
catggacagaacaagaaagggaaggacggagcgctgcttcctccacaactggctttgttt
gcaatagctactccacttcagccaccctccatcctggaaattcgaaccaaaaacttcatc
ttcaggaccaaacacaagctagacttcacacctattggttgtgatgccaaagggcagctt
attctgggctatacagaagtagagctgtgcacaagaggatcggggtaccagttcatccat
gctgcagacatacttcactgtgcagaatcccacatccgcatgattaagactggagaaagt
ggcatgacagttttccggcttcttgcaaaacacagtcgctggaggtgggtccagtccaat
gcacgcttgatttacagaaatggaagaccagattacatcatcgccactcagagaccactg
acggatgaagaaggacgagagcatttacagaagcgaagtacgtcgctgcccttcatgttt
gctaccggagaggctgtgttgtacgagatctccagccctttctctcccataatggatccc
ctaccaatacgcaccaaaagcaacactagcaggaaagactgggctccccagtcaacccca
agtaaggattctttccaccccagttctcttatgagtgccctcatccagcaggatgagtcc
atctatctgtgtcctccttcaagccctgcgctgttagacagccattttctcatgggctcc
gtgagcaagtgcgggagttggcaagacagctttgcggccgcaggaagtgaggctgcgctg
aaacatgagcaaattggccatgctcaggacgtgaaccttgcactctctggcggcccctca
gagctctttccggataataaaaataatgacttgtacagcatcatgaggaaccttgggatt
gattttgaagatatcagaagcatgcagaacgaggagttcttcagaactgactccaccgct
gctggtgaggttgacttcaaagacatcgacataacggacgaaatcctgacctacgtgcag
gattccctgaacaattcaactttgctgaactcggcttgccagcagcagcctgtgactcag
cacctaagctgtatgctgcaggagcgcctgcaactagagcaacagcaacagcttcagcag
cccccgccgcaggctctggagccccagcagcagctgtgtcagatggtgtgcccccagcaa
gatctgggtccgaagcacacgcaaatcaacggcacgtttgcaagttggaaccccacccct
cccgtgtctttcaactgtccccagcaggaactaaagcactatcagctcttttccagctta
caggggactgctcaggaatttccctacaaaccagaggtggacagtgtgccttacacacag
aactttgctccctgtaatcagcctctgcttccagaacattccaagagtgtgcagttggac
ttccctggaagggattttgaaccgtccctgcatcccactacttctaatttagattttgtc
agttgtttacaagttcctgaaaaccaaagtcatgggataaactcacagtccgccatggtc
agtcctcaggcatactatgctggggccatgtccatgtatcagtgccagccagggccacag
cgcacccctgtggaccagacgcagtacagctctgaaattccaggttctcaggcattccta
agcaaggtgcagagttga

DBGET integrated database retrieval system