KEGG   Mus musculus (mouse): 11692
Entry
11692             CDS       T01002                                 

Symbol
Gfer, Alr, ER, ERV1
Name
(RefSeq) growth factor, augmenter of liver regeneration
  KO
K17783  mitochondrial FAD-linked sulfhydryl oxidase [EC:1.8.3.2]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    11692 (Gfer)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.2  thiol oxidase
     11692 (Gfer)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Mitochondrial intermembrane space assembly (MIA) complex
    11692 (Gfer)
SSDB
Motif
Pfam: Evr1_Alr APOBEC4 SNAD4
Other DBs
NCBI-GeneID: 11692
NCBI-ProteinID: NP_075527
MGI: 107757
Ensembl: ENSMUSG00000040888
UniProt: P56213
Position
17 A3.3; 17 12.48 cM
AA seq 198 aa
MAAPSEPAGFPRGSRFSFLPGGARSEMTDDLVTDARGRGARHRDDTTPAAAPAPQGLEHG
KRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRHTWAFLHTLAAYYPDRPTPEQQQ
DMAQFIHIFSKFYPCEECAEDIRKRIGRNQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFD
CSRVDERWRDGWKDGSCD
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcggcgcccagcgagccggcgggcttccctcgcggcagtcgcttctccttcctgccg
ggcggcgcgcgctccgagatgaccgacgacctggtgactgacgcgcggggccgcggcgca
aggcatagagacgacaccacccctgccgcggccccggcgccgcaaggtttggagcacggg
aagcgaccgtgccgggcctgcgtggacttcaagtcgtggatgcggacccagcagaagcgg
gacatcaagtttagggaggactgtccacaggatcgggaagaattgggtcgccacacctgg
gctttcctccatacgctggccgcctattacccggacaggcccacgccagaacaacaacag
gatatggcccagttcatacatatattttccaagttttacccctgcgaggaatgtgcggaa
gacataaggaagaggataggcaggaaccagccagacacaagcactcgagtatccttcagc
cagtggctgtgccgcctgcacaatgaggtgaatcggaagctgggcaagcctgattttgac
tgctcgagagtagatgagcgttggcgtgacggctggaaggacggctcctgtgactag

DBGET integrated database retrieval system