KEGG   Mus musculus (house mouse): 12144
Entry
12144             CDS       T01002                                 
Symbol
Blm
Name
(RefSeq) Bloom syndrome, RecQ like helicase
  KO
K10901  bloom syndrome protein [EC:5.6.2.4]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    12144 (Blm)
   03460 Fanconi anemia pathway
    12144 (Blm)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    12144 (Blm)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12144 (Blm)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     12144 (Blm)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    12144 (Blm)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecQ family DNA helicases
     12144 (Blm)
    Bloom's syndrome complex (BTR)
     12144 (Blm)
   FA (Fanconi anemia) pathway
     12144 (Blm)
SSDB
Motif
Pfam: BLM_N BDHCT_assoc BDHCT DEAD RecQ_Zn_bind Helicase_C RQC HRDC ResIII
Other DBs
NCBI-GeneID: 12144
NCBI-ProteinID: NP_001035992
MGI: 1328362
Ensembl: ENSMUSG00000030528
UniProt: O88700
Position
7:complement(80104741..80184896)
AA seq 1416 aa
MAAVPLNNLQEQLQRHSARKLNNQPSLSKPKSLGFTFKKKTSEGDVSVTSVSVVKTPALS
DKDVNVSEAFSFTESPLHKPKQQAKIEGFFKHFPGRQQSKGTCSEPSLPATVQTAQDTLC
TTPKTPTAKKLPVAVFKKLEFSSSADSLSDWADMDDFDMSASDAFASLAKNPATRVSTAQ
KMKKTKRNFFKPPPRKANAVKTDLTPPSPECLQVDLTKESEEEEEEEEEAEGADCLSRDV
ICIDNDSASEELTEKDTQESQSLKAHLGAERGDSEKKSHEDEAVFHSVQNTEYFEHNDND
YDIDFVPPSPEEIISTASSSLKCSSMLKDLDDSDKEKGILSTSEELLSKPEEMTTHKSDA
GTSKDCDAQQIRIQQQLIHVMEHICKLVDTVPTDELEALNCGTELLQQRNIRRKLLAEAG
FNGNDVRLLGSLWRHRPDSLDNTVQGDSCPVGHPNKELNSPYLLSHSPSTEECLPTTTPG
KTGFSATPKNLFERPLLNSHLQKSFVSSNWAETPRMENRNESTDFPGSVLTSTTVKAQSK
QAASGWNVERHGQASYDIDNFNIDDFDDDDDDDDWENIMHNFPASKSSTATYPPIKEGGP
VKSLSERISSAKAKFLPVVSTAQNTNLSESIQNCSDKLAQNLSSKNPKHEHFQSLNFPHT
KEMMKIFHKKFGLHNFRTNQLEAINAALLGEDCFILMPTGGGKSLCYQLPACVSPGVTIV
ISPLRSLIVDQVQKLTSFDIPATYLTGDKTDSEAANIYLQLSKKDPIIKLLYVTPEKVCA
SNRLISTLENLYERKLLARFVIDEAHCVSQWGHDFRQDYKRMNMLRQKFPSVPVMALTAT
ANPRVQKDILTQLKILRPQVFSMSFNRHNLKYYVLPKKPKKVAFDCLEWIRKHHPYDSGI
IYCLSRRECDTMADTLQREGLAALAYHAGLSDSARDEVQHKWINQDNCQVICATIAFGMG
IDKPDVRFVIHASLPKSMEGYYQESGRAGRDGEISHCVLFYTYHDVTRLKRLIMMEKDGN
YHTKETHVNNLYSMVHYCENITECRRIQLLAYFGEKGFNPDFCKKYPDVSCDNCCKTKDY
KTKDVTDDVKNIIRFVQEHSSSPGTRNIGPAGRFTLNMLVDIFLGSKSAKVKSGIFGKGT
TYSRHNAERLFKKLILDKILDEDLYINANDQPIAYVMLGTKAHSVLSGHLKVDFMETENS
SSIKKQKALVAKVSQREEVVKKCLGELTEVCKLLGKVFGVHYFNIFNTATLKKLAESLSS
DPEVLLQIDGVTEDKLEKYGAEVIPVLQKYSEWTVPAEDGSPGARGAPEDTEEEEEEAPV
SSHYFANQTRNERKRKKMSATHKPKRRRTSYGGFRAKGGSTTCRKTTSKSKFYGVTGSRS
ASCASQATSSASRKLGIMAPPKPVNRTFLRPSYAFS
NT seq 4251 nt   +upstreamnt  +downstreamnt
atggctgctgttcctctgaacaatctacaagaacaactacagcgacactcagccagaaaa
cttaataatcaacccagcctttcaaaaccaaaatctttaggttttacttttaaaaagaaa
acatcagagggtgatgtgtctgtcactagtgtgtccgtagtaaaaacacctgcgttaagt
gataaagatgtgaacgtgtctgaggccttttcattcactgagtctccactccacaaacca
aagcagcaggcaaagattgaaggcttctttaaacatttccctggaaggcagcaaagcaag
gggacctgctctgagccgtcactgccggccacggtacagactgctcaggacactttgtgc
actacccccaaaacccccactgcgaagaaactgcccgtggctgttttcaagaaattagaa
tttagttcttctgcagactccctcagtgactgggctgatatggatgactttgatatgtca
gcatcagatgcgtttgcttcactggctaaaaatcctgccacaagagtaagcaccgctcag
aaaatgaaaaagactaagagaaacttctttaaaccaccacctcgtaaagccaatgcagta
aagactgacttgactcctccctcccccgaatgcctgcaagtggatttaacgaaggaatcg
gaggaggaggaggaggaggaggaggaggcggagggggcggactgcctgagcagggatgtg
atctgcattgacaatgattctgcttctgaagagctcacggagaaagacacgcaggaaagc
cagtctttgaaagctcacttgggagctgaaagaggtgacagtgaaaagaagagccatgaa
gacgaagctgtgttccattcagttcagaacactgaatactttgaacacaatgacaatgat
tatgatatagattttgttccaccttctccagaagaaatcatctccactgcttcttcctcg
ttgaaatgttccagtatgttaaaggatcttgatgactctgacaaagaaaagggcattctt
agcacctcagaagagcttctgtcaaaaccagaggaaatgaccacacacaagtctgatgca
ggaaccagtaaagactgtgatgcccagcagatacgcatacagcagcagcttattcatgtg
atggagcacatctgtaagttagttgatactgttcctactgatgaactggaagctttgaat
tgtgggaccgaattgcttcaacaacgaaacataaggaggaagctcctagctgaagcaggt
tttaatggaaatgacgtcagacttctgggttctctgtggaggcacaggcctgattcactt
gataacacagtgcagggcgactcctgccctgtggggcatcctaataaagagttaaattct
ccataccttctctcacattccccttccactgaggaatgtttacccaccaccactccagga
aagacaggattctcagccaccccgaagaatctctttgaaaggccgttattgaattcccat
ttacagaagtcctttgtaagtagcaactgggctgaaacaccaaggatggaaaacaggaac
gaaagcactgacttcccagggagtgttctcaccagcaccactgtgaaagctcagagtaaa
caagctgcttcaggatggaacgtagagagacacggccaggcttcctatgatatcgataac
tttaatattgatgactttgatgatgatgatgatgatgatgactgggaaaacataatgcac
aattttccagccagcaaatcttccacagccacctacccacccatcaaggaaggtgggcca
gttaaatctctctcagaaaggatttcttcagccaaggcaaagtttcttccagtggtatca
accgctcaaaatacaaacctctcagagtcaattcagaattgctctgataagctggcccaa
aatttatcatcaaaaaatccaaaacatgaacattttcaaagtcttaattttcctcataca
aaagaaatgatgaagattttccataagaaatttggcttgcataattttagaactaatcag
ctagaggcgatcaatgctgcgctgcttggtgaagactgctttatcctaatgcccactgga
ggaggtaaaagtttgtgctaccagctccctgcctgtgtttctcctggggtcacaattgtc
atttctcccttgagatcactaatagtagatcaagtccaaaagctgacttcctttgatatt
ccagctacatatctgacaggggataagactgactcagaagctgcaaatatttacctccaa
ttatccaaaaaagacccaatcatcaagcttttgtatgttactccagagaaggtctgtgca
agtaacaggctgatttctactctggagaatctgtatgagcggaagctcttggcacgtttt
gtcattgatgaagcgcattgtgtgagtcagtggggtcatgattttcgtcaagattacaaa
aggatgaatatgcttcgccagaagtttccttctgttccagtgatggccctcacggccaca
gcgaaccccagggtccagaaggacatcctcactcagctgaagatcctcagacctcaggtg
tttagcatgagctttaacagacacaatctgaagtactatgtattacccaagaagcccaaa
aaagtagcatttgattgcctagagtggatcagaaagcatcacccttatgactcggggata
atttactgcctctccaggagggaatgtgacacaatggctgacactttacagagagaaggc
ctggctgccctggcttaccatgcgggcctcagtgactctgccagagatgaggtgcagcac
aagtggatcaaccaggacaactgccaggttatctgtgcgacaattgcgtttggaatggga
attgacaaacctgacgtgcgatttgtgattcatgcatctcttcctaaatctatggagggt
tattatcaagaatccggccgagctggaagagatggggaaatatctcactgcgtgcttttc
tatacatatcatgatgtgaccagactgaagagacttataatgatggaaaaagatggaaac
tatcatacgaaggaaactcacgtcaataatctatatagcatggtacattactgtgaaaac
ataacggaatgcagaagaatacagcttttagcttactttggtgaaaaaggattcaaccct
gatttttgtaagaaatacccagatgtttcttgtgacaattgctgtaaaacaaaggattat
aaaacaaaagatgtgactgatgacgtgaaaaatattataagatttgttcaagaacacagt
tcatcaccaggaacaagaaatataggacctgctggaagatttactctgaacatgctggtc
gacattttcttggggagcaagagtgcaaaagttaagtctggaatatttggaaaggggact
acatattcacgacataatgccgaaagactttttaaaaagctgattctagacaaaatcctg
gatgaagacttatatatcaatgccaatgaccaaccaattgcctatgtgatgctaggaaca
aaagcccacagtgtgctgagtggccacttgaaggtggacttcatggaaacggaaaattcc
agcagtattaaaaaacaaaaagctttagtggccaaagtatcccagagagaagaggtagtt
aagaaatgtcttggagaacttacagaggtctgcaaattgctggggaaagtctttggtgtc
cattacttcaatatttttaatacagccacactcaaaaagcttgcagaatctttatcttct
gatcctgaggttttgcttcagattgatggtgttaccgaagacaagctggaaaaatatggt
gcagaagtgattccagtattacagaagtactcagaatggacagtgccagctgaggatggt
tccccaggcgccagaggcgccccagaggacactgaggaggaggaggaggaagcgcctgta
tcttctcactactttgcaaatcaaactagaaatgaaagaaagagaaagaaaatgtcagcc
acccataagcccaagaggagaagaactagttacggtggcttcagagcaaaggggggctct
actacatgcagaaaaacgacttctaaaagtaaattctatggtgtaactggatcccgctcg
gcctcatgtgcttctcaggcaacatcatcagccagtagaaaactggggattatggctcct
ccaaagcctgtaaatagaacgttcctcaggccttcatatgccttctcctaa

DBGET integrated database retrieval system