KEGG   Mus musculus (house mouse): 12151
Entry
12151             CDS       T01002                                 
Symbol
Bmi1, AW546694, Bmi-1, Pcgf4
Name
(RefSeq) Bmi1 polycomb ring finger oncogene
  KO
K11459  polycomb group RING finger protein 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12151 (Bmi1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    12151 (Bmi1)
   05206 MicroRNAs in cancer
    12151 (Bmi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12151 (Bmi1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     12151 (Bmi1)
SSDB
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-RING_10 zf-Nse
Other DBs
NCBI-GeneID: 12151
NCBI-ProteinID: NP_031578
MGI: 88174
Ensembl: ENSMUSG00000026739
UniProt: P25916 Q2LC58
Structure
Position
2:18681829..18691440
AA seq 324 aa
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQV
HKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE
EKRIITDDEIISLSIEFFDQSRLDRKVNKEKPKEEVNDKRYLRCPAAMTVMHLRKFLRSK
MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKMSHQRDG
LTNAGELESDSGSDKANSPAGGVPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSA
NHQSSFASRPRKSSLNGSSATSSG
NT seq 975 nt   +upstreamnt  +downstreamnt
atgcatcgaacaaccagaatcaagatcactgagctaaatccccacttaatgtgtgtcctg
tgtggagggtacttcattgatgccactaccataatagaatgtctacattccttctgtaaa
acatgtattgtacgttacttggagaccagcaagtattgtcctatttgtgatgtccaggtt
cacaaaaccagaccactcctgaacataaggtcagataaaactcttcaagatattgtatac
aaattagtcccagggcttttcaaaaatgagatgaagagaagaagagatttttatgcagct
cacccgtcagctgatgctgccaatggctccaatgaagaccgaggagaagttgcagatgag
gagaagaggattataactgatgatgagataataagcttgtctattgagttctttgatcag
agcagattggatcggaaagtaaataaagagaagcctaaggaagaggtgaatgataaaagg
tacttacgatgcccagcagcaatgactgtgatgcacttgagaaagtttctcaggagtaaa
atggacatacccaatactttccagattgacgtcatgtatgaagaggaacctttaaaggat
tactacacgctaatggacattgcctacatttatacctggagaagaaatggcccactacct
ttgaaatacagagttcggccaacttgcaaaagaatgaagatgagtcaccagagggatgga
ctgacgaatgctggagagctggaaagtgactctgggagtgacaaggccaacagcccagcc
ggaggtgttccctccacctcttcctgtttgcccagtcccagcactccagtgcagtctcct
cacccacagttccctcacatttccagtaccatgaatggaaccagcaacagccccagtgct
aaccaccaatcttcctttgccagtagacctcgaaaatcatcactaaatgggtcatcagca
acttcatctggttag

DBGET integrated database retrieval system