KEGG   Mus musculus (house mouse): 12224
Entry
12224             CDS       T01002                                 
Symbol
Klf5, 4930520J07Rik, Bteb2, CKLF, IKLF
Name
(RefSeq) Kruppel-like factor 5
  KO
K09206  krueppel-like factor 5
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    12224 (Klf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    12224 (Klf5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    12224 (Klf5)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-met
Other DBs
NCBI-GeneID: 12224
NCBI-ProteinID: NP_033899
MGI: 1338056
Ensembl: ENSMUSG00000005148
UniProt: Q9Z0Z7
Position
14:99536127..99550848
AA seq 446 aa
MPTRVLTMSARLGPLPQPPAAQDEPVFAQLKPVLGAANPARDAALFSGDDLKHAHHHPPA
PPPAAGPRLPSEELVQTRCEMEKYLTPQLPPVPIISEHKKYRRDSASVVDQFFTDTEGIP
YSINMNVFLPDITHLRTGLYKSQRPCVTQIKTEPVTIFSHQSESTAPPPPPAPTQALPEF
TSIFSSHQTTAPPQEVNNIFIKQELPIPDLHLSVPSQQGHLYQLLNTPDLDMPSSTNQTA
VMDTLNVSMAGLNPHPSAVPQTSMKQFQGMPPCTYTMPSQFLPQQATYFPPSPPSSEPGS
PDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPVNSPTLPPVRYNRRSNPDLEKRR
IHFCDYNGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAK
PFQCMVCQRSFSRSDHLALHMKRHQN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgcccacgcgggtgctgaccatgagcgcccgcctgggaccactgccccagccgccggcc
gcgcaggacgagcccgtgttcgcgcagctcaagccggtgctgggcgctgcgaacccggcc
cgcgacgcggcgctcttctccggagacgatctgaaacacgcgcaccaccacccgcctgcg
ccgccgccagccgctggcccgcgactgccctcggaggagctggtccagacaagatgtgaa
atggagaagtatctgacccctcagctccctccagttccgataatttcagagcataaaaag
tatagacgagacagtgcctcagtggtagaccagttcttcactgacactgaaggcatacct
tacagcatcaacatgaacgtcttcctccctgacatcactcacctgagaactggcctctac
aaatcccagagaccatgcgtaacacagatcaagacagaacctgttaccattttcagccac
cagagcgagtcgacggcccctcctcctcctccggcccccacccaggctctccccgagttc
actagtatcttcagctcccaccagaccacagcgccaccacaggaggtgaacaatatcttc
atcaaacaagaacttcctataccagatcttcatctctctgtcccttcccagcagggccac
ctgtaccagctgttgaatacaccggatctagacatgcccagttcgacaaaccagacggca
gtaatggacacccttaatgtttctatggcaggccttaacccacacccctctgctgttcca
cagacgtcaatgaaacagttccagggcatgcccccttgcacgtacaccatgccaagtcag
tttcttccacagcaggccacctactttcccccgtcaccaccaagctcagagcctggaagt
cccgatagacaagctgagatgctgcagaatctcaccccacctccgtcctatgccgctaca
attgcttccaaactggcgattcacaacccaaatttacctgccactctgccagttaattcg
ccaactctcccacctgtcagatacaacagaaggagtaacccggatctggagaagcgacgt
atccacttctgcgattataatggttgcacaaaagtttatacaaagtcgtctcacttaaaa
gctcacctgaggactcatacgggcgagaagccctacaagtgcacctgggagggctgcgac
tggaggtttgcccggtcggatgagctgacccgccactacaggaagcacacgggcgccaag
ccgttccagtgcatggtgtgccaacgcagcttctcccgctccgaccacctcgcgctgcac
atgaagcgccaccagaactga

DBGET integrated database retrieval system