KEGG   Mus musculus (mouse): 12266
Entry
12266             CDS       T01002                                 

Gene name
C3, AI255234, ASP, HSE-MSF, Plp
Definition
(RefSeq) complement component 3
  KO
K03990  complement component 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05203  Viral carcinogenesis
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12266 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12266 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12266 (C3)
   04613 Neutrophil extracellular trap formation
    12266 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    12266 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12266 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12266 (C3)
   05134 Legionellosis
    12266 (C3)
   05150 Staphylococcus aureus infection
    12266 (C3)
   05152 Tuberculosis
    12266 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12266 (C3)
   05168 Herpes simplex virus 1 infection
    12266 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    12266 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    12266 (C3)
   05142 Chagas disease
    12266 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12266 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12266 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12266 (C3)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   12266 (C3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12266 (C3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   12266 (C3)
SSDB
Motif
Pfam: TED_complement A2M A2M_BRD A2M_recep NTR MG4 MG1 MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 12266
NCBI-ProteinID: NP_033908
MGI: 88227
Ensembl: ENSMUSG00000024164
Vega: OTTMUSG00000042133
UniProt: P01027
Position
17 D; 17 29.72 cM
AA seq 1663 aa
MGPASGSQLLVLLLLLASSPLALGIPMYSIITPNVLRLESEETIVLEAHDAQGDIPVTVT
VQDFLKRQVLTSEKTVLTGASGHLRSVSIKIPASKEFNSDKEGHKYVTVVANFGETVVEK
AVMVSFQSGYLFIQTDKTIYTPGSTVLYRIFTVDNNLLPVGKTVVILIETPDGIPVKRDI
LSSNNQHGILPLSWNIPELVNMGQWKIRAFYEHAPKQIFSAEFEVKEYVLPSFEVRVEPT
ETFYYIDDPNGLEVSIIAKFLYGKNVDGTAFVIFGVQDGDKKISLAHSLTRVVIEDGVGD
AVLTRKVLMEGVRPSNADALVGKSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTK
TPKFFKPAMPFDLMVFVTNPDGSPASKVLVVTQGSNAKALTQDDGVAKLSINTPNSRQPL
TITVRTKKDTLPESRQATKTMEAHPYSTMHNSNNYLHLSVSRMELKPGDNLNVNFHLRTD
PGHEAKIRYYTYLVMNKGKLLKAGRQVREPGQDLVVLSLPITPEFIPSFRLVAYYTLIGA
SGQREVVADSVWVDVKDSCIGTLVVKGDPRDNHLAPGQQTTLRIEGNQGARVGLVAVDKG
VFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKNYAGVFMDAGLAFKTSQGLQTEQRADLE
CTKPAARRRRSVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENC
IKAFIDCCNHITKLREQHRRDHVLGLARSELEEDIIPEEDIISRSHFPQSWLWTIEELKE
PEKNGISTKVMNIFLKDSITTWEILAVSLSDKKGICVADPYEIRVMQDFFIDLRLPYSVV
RNEQVEIRAVLFNYREQEELKVRVELLHNPAFCSMATAKNRYFQTIKIPPKSSVAVPYVI
VPLKIGQQEVEVKAAVFNHFISDGVKKTLKVVPEGMRINKTVAIHTLDPEKLGQGGVQKV
DVPAADLSDQVPDTDSETRIILQGSPVVQMAEDAVDGERLKHLIVTPAGCGEQNMIGMTP
TVIAVHYLDQTEQWEKFGIEKRQEALELIKKGYTQQLAFKQPSSAYAAFNNRPPSTWLTA
YVVKVFSLAANLIAIDSHVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRNAKEAD
VSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALMN
KLEEPYLGKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQTDVPDHKDLNMDVSFHLPSRSSATTFRLLWENGNLLR
SEETKQNEAFSLTAKGKGRGTLSVVAVYHAKLKSKVTCKKFDLRVSIRPAPETAKKPEEA
KNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSN
KNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDG
MLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDE
YTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSY
IIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
NT seq 4992 nt   +upstreamnt  +downstreamnt
atgggaccagcttcagggtcccagctactagtgctactgctgctgttggccagctcccca
ttagctctggggatccccatgtattccatcattactcccaatgtcctacggctggagagc
gaagagaccatcgtactggaggcccacgatgctcagggtgacatcccagtcacagtcact
gtgcaagacttcctaaagaggcaagtgctgaccagtgagaagacagtgttgacaggagcc
agtggacatctgagaagcgtctccatcaagattccagccagtaaggaattcaactcagat
aaggaggggcacaagtacgtgacagtggtggcaaacttcggggaaacggtggtggagaaa
gcagtgatggtaagcttccagagtgggtacctcttcatccagacagacaagaccatctac
acccctggctccactgtcttatatcggatcttcactgtggacaacaacctactgcccgtg
ggcaagacagtcgtcatcctcattgagacccccgatggcattcctgtcaagagagacatt
ctgtcttccaacaaccaacacggcatcttgcctttgtcttggaacattcctgaactggtc
aacatggggcagtggaagatccgagccttttacgaacatgcgccgaagcagatcttctcc
gcagagtttgaggtgaaggaatacgtgctgcccagttttgaggtccgggtggagcccaca
gagacattttattacatcgatgacccaaatggcctggaagtttccatcatagccaagttc
ctgtacgggaaaaacgtggacgggacagccttcgtgatttttggggtccaggatggcgat
aagaagatttctctggcccactccctcacgcgcgtagtgattgaggatggtgtgggggat
gcagtgctgacccggaaggtgctgatggagggggtacggccttccaacgccgacgccctg
gtggggaagtccctgtatgtctccgtcactgtcatcctgcactcaggtagtgacatggta
gaggcagagcgcagtgggatcccgattgtcacttccccgtaccagatccacttcaccaag
acacccaaattcttcaagccagccatgccctttgacctcatggtgttcgtgaccaacccc
gatggctctccggccagcaaagtgctggtggtcactcagggatctaatgcaaaggctctc
acccaagatgatggcgtggccaagctaagcatcaacacacccaacagccgccaacccctg
accatcacagtccgcaccaagaaggacactctcccagaatcacggcaggccaccaagaca
atggaggcccatccctacagcactatgcacaactccaacaactacctacacttgtcagtg
tcacgaatggagctcaagccgggggacaacctcaatgtcaacttccacctgcgcacagac
ccaggccatgaggccaagatccgatactacacctacctggttatgaacaaggggaagctc
ctgaaggcaggccgccaggttcgggagcctggccaggacctggtggtcttgtccctgccc
atcactccagagtttattccttcatttcgcctggtggcttactacaccctgattggagct
agtggccagagggaggtggtggctgactctgtgtgggtggatgtgaaggattcctgtatt
ggcacgctggtggtgaagggtgacccaagagataaccatctcgcacctgggcaacaaacg
acactcaggattgaaggaaaccagggggcccgagtggggctagtggctgtggacaaggga
gtgtttgtgctgaacaagaagaacaaactcacacagagcaagatctgggatgtggtagag
aaggcagacattggctgcaccccaggcagtgggaagaactatgctggtgtcttcatggat
gcaggcctggccttcaagacaagccaaggactgcagactgaacagagagcagatcttgag
tgcaccaagccagcagcccgccgccgtcgctcagtacagttgatggaaagaaggatggac
aaagctggtcagtacactgacaagggtcttcggaagtgttgtgaggatggtatgcgggat
atccctatgagatacagctgccagcgccgggcacgcctcatcacccagggcgagaactgc
ataaaggccttcatagactgctgcaaccacatcaccaagctgcgtgaacaacacagaaga
gaccacgtgctgggcctggccaggagtgaattggaggaagacataattccagaagaagat
attatctctagaagccacttcccacagagctggttgtggaccatagaagagttgaaagaa
ccagagaaaaatggaatctctacgaaggtcatgaacatctttctcaaagattccatcacc
acctgggagattctggcagtgagcttgtcagacaagaaagggatctgtgtggcagacccc
tatgagatcagagtgatgcaggacttcttcattgacctgcggctgccctactctgtagtg
cgcaacgaacaggtggagatcagagctgtgctcttcaactaccgtgaacaggaggaactt
aaggtgagggtggaactgttgcataatccagccttctgcagcatggccaccgccaagaat
cgctacttccagaccatcaaaatccctcccaagtcctcggtggctgtaccgtatgtcatt
gtccccttgaagatcggccaacaagaggtggaggtcaaggctgctgtcttcaatcacttc
atcagtgatggtgtcaagaagacactgaaggtcgtgccagaaggaatgagaatcaacaaa
actgtggccatccatacactggacccagagaagctcggtcaagggggagtgcagaaggtg
gatgtgcctgccgcagaccttagcgaccaagtgccagacacagactctgagaccagaatt
atcctgcaagggagcccggtggttcagatggctgaagatgctgtggacggggagcggctg
aaacacctgatcgtgacccccgcaggctgtggggaacagaacatgattggcatgacacca
acagtcattgcggtacactacctggaccagaccgaacagtgggagaagttcggcatagag
aagaggcaagaggccctggagctcatcaagaaagggtacacccagcagctggccttcaaa
cagcccagctctgcctatgctgccttcaacaaccggccccccagcacctggctgacagcc
tacgtggtcaaggtcttctctctagctgccaacctcatcgccatcgactctcacgtcctg
tgtggggctgttaaatggttgattctggagaaacagaagccggatggtgtctttcaggag
gatgggcccgtgattcaccaagaaatgattggtggcttccggaacgccaaggaggcagat
gtgtcactcacagccttcgtcctcatcgcactgcaggaagccagggacatctgtgagggg
caggtcaatagccttcctgggagcatcaacaaggcaggggagtatattgaagccagttac
atgaacctgcagagaccatacacagtggccattgctgggtatgccctggccctgatgaac
aaactggaggaaccttacctcggcaagtttctgaacacagccaaagatcggaaccgctgg
gaggagcctgaccagcagctctacaacgtagaggccacatcctacgccctcctggccctg
ctgctgctgaaagactttgactctgtgccccctgtagtgcgctggctcaatgagcaaaga
tactacggaggcggctatggctccacccaggctaccttcatggtattccaagccttggcc
caatatcaaacagatgtccctgaccataaggacttgaacatggatgtgtccttccacctc
cccagccgtagctctgcaaccacgtttcgcctgctctgggaaaatggcaacctcctgcga
tcggaagagaccaagcaaaatgaggccttctctctaacagccaaaggaaaaggccgaggc
acattgtcggtggtggcagtgtatcatgccaaactcaaaagcaaagtcacctgcaagaag
tttgacctcagggtcagcataagaccagcccctgagacagccaagaagcccgaggaagcc
aagaataccatgttccttgaaatctgcaccaagtacttgggagatgtggacgccactatg
tccatcctggacatctccatgatgactggctttgctccagacacaaaggacctggaactg
ctggcctctggagtagatagatacatctccaagtacgagatgaacaaagccttctccaac
aagaacaccctcatcatctacctagaaaagatttcacacaccgaagaagactgcctgacc
ttcaaagttcaccagtactttaatgtgggacttatccagcccgggtcggtcaaggtctac
tcctattacaacctcgaggaatcatgcacccggttctatcatccagagaaggacgatggg
atgctcagcaagctgtgccacagtgaaatgtgccggtgtgctgaagagaactgcttcatg
caacagtcacaggagaagatcaacctgaatgtccggctagacaaggcttgtgagcccgga
gtcgactatgtgtacaagaccgagctaaccaacatagagctgttggatgattttgatgag
tacaccatgaccatccagcaggtcatcaagtcaggctcagatgaggtgcaggcagggcag
caacgcaagttcatcagccacatcaagtgcagaaacgccctgaagctgcagaaagggaag
aagtacctcatgtggggcctctcctctgacctctggggagaaaagcccaacaccagctac
atcattgggaaggacacgtgggtggagcactggcctgaggcagaagaatgccaggatcag
aagtaccagaaacagtgcgaagaacttggggcattcacagaatctatggtggtttatggt
tgtcccaactga

DBGET integrated database retrieval system