KEGG   Mus musculus (mouse): 12402Help
Entry
12402             CDS       T01002                                 

Gene name
Cbl, 4732447J05Rik, Cbl-2, c-Cbl
Definition
(RefSeq) Casitas B-lineage lymphoma
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04910  Insulin signaling pathway
mmu05100  Bacterial invasion of epithelial cells
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12402 (Cbl)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    12402 (Cbl)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    12402 (Cbl)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    12402 (Cbl)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    12402 (Cbl)
   05205 Proteoglycans in cancer
    12402 (Cbl)
   05220 Chronic myeloid leukemia
    12402 (Cbl)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    12402 (Cbl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     12402 (Cbl)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    12402 (Cbl)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    12402 (Cbl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 12402
NCBI-ProteinID: NP_031645
MGI: 88279
Ensembl: ENSMUSG00000034342
Vega: OTTMUSG00000058274
UniProt: P22682
Position
9 A5.1-A5.2; 9 24.72 cM
AA seq 913 aa AA seqDB search
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKL
MDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENL
MKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQ
WAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIK
VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE
IKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPS
SPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASKAASGSLHKDKPLPIPPTLRDL
PPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVAT
PNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRLGSTFSLDTSMTMNSSPVAGPESEHP
KIKPSSSANAIYSLAARPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEAT
QSSRACDCDQQIDSCTYEAMYNIQSQALSVAENSASGEGNLATAHTSTGPEESENEDDGY
DVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTNFNEGSQVPERPPKPFPRRINSER
KASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILR
EFVSISSPAHVAT
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctcgggcgccggcggcggcggctctgggggctcggga
gcgggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccaccac
ctcagcccgcaccctccctgcacggtggacaagaagatggtggagaagtgctggaagctc
atggacaaggtggtgcggttgtgtcaaaacccaaagctggcgctcaagaacagcccgcct
tatatcttagacctgctgcctgacacctaccagcacctccgcactgtcttgtcaagatat
gaggggaagatggagacgcttggagaaaatgagtatttcagggtgttcatggaaaatttg
atgaagaaaactaagcagactatcagcctcttcaaggagggaaaagaaaggatgtatgag
gagaattcccagcctaggcgaaacctgaccaaattatccctgatcttcagccacatgctg
gcagaactgaaaggcatctttccgagcggactcttccaaggagacactttccggattact
aaagctgatgctgccgaattttggagaaaagcttttggtgaaaagacgatagtcccgtgg
aagagctttcgacaggccctgcatgaagtgcatcccatcagttctgggctggaggccatg
gctctgaagtccactattgatctgacctgcaatgattatatttctgtctttgaatttgat
atttttacacggctgtttcagccctggtcctctttgctcagaaattggaacagccttgct
gtaactcaccctggttacatggctttcctgacatacgatgaagtgaaagcgcgcctgcag
aagttcatccacaaacctggcagttacatctttcggctgagctgtactcgtttgggtcag
tgggctattgggtatgttactgccgatgggaacattctgcagacaatcccacacaataaa
ccgctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcctgatgga
cgaaatcaaaatcctgacctgacaggtttatgtgaaccaactcctcaagatcatatcaaa
gtaacccaggaacaatatgaattatactgtgaaatgggctccacatttcaactgtgtaag
atatgtgctgagaatgataaggatgtgaagattgagccctgtggacacctcatgtgcaca
tcctgcctcacgtcgtggcaggaatcagaaggtcagggctgtcctttttgccgatgtgaa
atcaaaggtactgagcccatcgtggtggatccgtttgaccccagaggcagtggcagccta
ttaaggcaaggagcagaaggtgctccttccccaaattacgacgatgatgatgatgaacga
gctgatgattctctcttcatgatgaaggagttggcaggtgccaaggtggaaaggccttcc
tctccattctccatggccccacaagcttcccttcctccagtgccaccaagacttgacctt
ctacagcagcgagcacctgttcctgccagcacttcagttctggggactgcttccaaggct
gcttctggctcccttcataaagacaaaccattgccaatacctcccacacttcgagatctt
ccaccaccaccccctccagaccggccttactctgttggagcagaaacaaggcctcagaga
cgccctctgccttgtacaccaggcgattgtccatctagagacaaactgccccctgtccct
tctagccgcccaggggactcgtggttgtctcggccaatccctaaagtaccagtagctact
ccaaaccctggtgatccttggaatgggagagaattgaccaatcggcactcgcttccattc
tcattgccctcacaaatggaacccagagcagatgtccctaggcttggaagcacatttagt
ctggatacctctatgactatgaatagcagcccagtagcaggtccagagagtgagcaccca
aagatcaagccttcctcgtctgccaacgccatttactctctggctgccaggcctcttcct
atgccaaaactgccacctggggagcaaggggaaagtgaagaggacacagaatatatgact
cccacatctaggcctgtaggggttcagaagccagagcccaaacggccgttagaggcaacc
cagagttcacgagcatgtgactgtgaccagcagatcgacagctgtacctatgaagcgatg
tataacatccagtcccaagcactgtctgtagcagaaaacagcgcctctggggaagggaat
ctggccacagctcacacgagtactggccctgaggaatccgaaaacgaggatgatggctat
gatgtgcctaagccacccgtgccagctgtactggcccgccggaccctgtctgacatctcc
aatgccagctcctcctttggctggttgtctttggatggtgaccctacaaacttcaatgag
ggttcccaagttcctgagcggccccccaaaccattccctcggagaatcaactcagaacga
aaagccagtagctatcaacaaggcggaggtgccactgctaaccctgtggccacagcaccc
tcaccgcagctctcaagtgagattgaacgcctcatgagtcagggctattcctaccaggac
attcagaaagctttggtcattgcccacaacaacattgagatggctaaaaacatcctccgg
gaatttgtttctatttcttctcctgctcacgtagccacctag

DBGET integrated database retrieval system