KEGG   Mus musculus (mouse): 12539
Entry
12539             CDS       T01002                                 

Gene name
Cdc37, p50, p50Cdc3, p50Cdc37
Definition
(RefSeq) cell division cycle 37
  KO
K09554  cell division cycle protein 37
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12539 (Cdc37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12539 (Cdc37)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    12539 (Cdc37)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12539 (Cdc37)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Cdc37 / p50
   12539 (Cdc37)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    12539 (Cdc37)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Intracellular proteins
   12539 (Cdc37)
SSDB
Motif
Pfam: CDC37_M CDC37_C CDC37_N Med4 Atg14 LMBR1
Other DBs
NCBI-GeneID: 12539
NCBI-ProteinID: NP_058022
MGI: 109531
Ensembl: ENSMUSG00000019471
Vega: OTTMUSG00000063152
UniProt: Q61081
Position
9; 9 A3
AA seq 379 aa
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAESDGQVELERLRAEAQQLRKEERSWEQKLEDMRKKEKNMPWNVDTL
SKDGFSKSMVNTKPEKAEEDSEEAREQKHKTFVEKYEKQIKHFGMLHRWDDSQKYLSDNV
HLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTMVMQFILELAKSLKVDPRACFRQFFT
KIKTADHQYMEGFKYELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYE
SLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKSGEAKEGEEAGP
GDPLLEAVPKAGNEKDVSA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggtggactacagcgtttgggatcacatcgaggtgtcggacgatgaggacgagacgcac
cccaacatagacactgccagcctcttccgctggcggcaccaggcccgggtggaacgcatg
gagcagtttcagaaggagaaagaggaactggaccggggctgccgggagtgcaagcgcaag
gtagccgagtgccagcgcaagctgaaggagctggaagtggctgagagcgatggccaggtg
gagcttgagcggctgagagctgaggcacagcaactgcgcaaggaggagcggagctgggag
cagaagctggaagacatgcgcaaaaaggagaagaacatgccctggaatgtggacacgctc
agcaaagatggctttagcaagagcatggtcaataccaagcctgagaaggcagaggaggac
tcagaggaggcaagggagcagaaacacaagaccttcgttgaaaaatatgagaaacagatc
aagcatttcggcatgctccaccgctgggatgacagccagaaatacctgtcggacaacgtc
cacctggtgtgtgaggaaacggccaactacctggttatctggtgcattgacctggaggta
gaggagaaatgtgcactgatggagcaggtagctcaccagaccatggtgatgcagtttatt
ctggagctggccaagagtctgaaggtcgacccccgagcctgcttccggcagtttttcacc
aagatcaagaccgctgaccaccagtacatggagggcttcaagtatgaactggaagccttt
aaggagcgagtgcggggccgcgccaagctgcgaatagagaaggccatgaaggaatatgaa
gaggaggagcgcaagaagaggctaggccctggtggcctggaccccgtggaggtctacgaa
tccctgcctgaggagctgcagaagtgctttgatgtgaaggatgtacagatgctgcaagac
gccatcagcaaaatggatcccactgatgccaagtatcacatgcagcgttgcatcgattct
ggcctctgggtccccaactccaagtctggtgaggccaaggagggggaggaggcgggcccc
ggggacccattgctggaagccgtccccaaagcgggcaacgagaaagacgtcagtgcgtga

DBGET integrated database retrieval system