KEGG   Mus musculus (house mouse): 13018
Entry
13018             CDS       T01002                                 
Symbol
Ctcf
Name
(RefSeq) CCCTC-binding factor
  KO
K23195  transcriptional repressor CTCF
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    13018 (Ctcf)
   03036 Chromosome and associated proteins [BR:mmu03036]
    13018 (Ctcf)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    13018 (Ctcf)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    13018 (Ctcf)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-met zf-C2HE zf-C2H2_6
Other DBs
NCBI-GeneID: 13018
NCBI-ProteinID: NP_851839
MGI: 109447
Ensembl: ENSMUSG00000005698
UniProt: Q61164
Position
8:106351135..106409554
AA seq 736 aa
MEGEAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDSSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSEENAEPDLDDNEEEEEPAVEIEPEPEPQPQPPPPPQPVAPAPPPAKKR
RGRPPGRTNQPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQAATTDA
PNGDLTPEMILSMMDR
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggaaggtgaggcggttgaagccattgtggaggagtctgaaactttcattaaaggaaaa
gaaagaaagacttaccagagacgccgggaagggggccaggaagaagatgcttgccacctg
ccccagaaccagacagatgggggtgaggtggtccaggatgtcaacagcagtgtacagatg
gtaatgatggaacagctggatcctacccttctccagatgaagactgaagtcatggagggt
acagtggctccggaagcagaggctgcagtggacgatacccagatcataaccttgcaggtt
gtaaatatggaggaacagcccattaacataggagagcttcagcttgtccaagtacctgtt
cctgtgacggtacctgttgctactacttcagtagaagaacttcagggggcttatgagaat
gaagtgtctaaagagggccttgcagaaagtgaaccgatgatatgtcacaccttacctttg
cctgaaggatttcaggtggtgaaagtgggggccaatggagaagtggagacactagagcag
ggcgagcttcctcctcaggaagactctagctggcaaaaagacccagactatcagccacca
gccaaaaaaacaaagaaaaccaaaaagagcaaacttcgttacacagaagagggcaaagac
gtggatgtgtctgtgtatgattttgaggaagaacagcaggaaggactgctgtctgaggtt
aatgcagagaaagtagttggtaatatgaagcctccgaagccaacaaaaattaaaaaaaaa
ggtgtaaagaaaacattccagtgtgagctttgcagttacacatgtccccggcgttcaaat
ttggatcgtcacatgaaaagccacactgatgagagaccacacaaatgccatctgtgtggc
agagcattcagaacagtgaccctcctgaggaatcatctgaacacacacacaggtactcgt
cctcacaagtgcccagactgcgatatggcctttgtgaccagtggagaattggtgcggcat
cgtcgttataaacacactcatgagaaaccatttaagtgttccatgtgtgattatgccagt
gtagaagtcagcaaattaaaacgacacattcgctctcatactggagagcgcccgttccag
tgcagtttgtgcagttatgccagcagggacacatacaagctgaaaaggcatatgagaacc
cattcaggggaaaaaccttatgaatgttatatttgtcacgctcggtttacccagagtggt
accatgaagatgcacattttacagaagcacacagaaaatgtggccaaatttcattgtccc
cattgtgacactgtcatagcccgaaaaagtgatttgggtgtccacttgcgaaagcagcat
tcctatattgaacagggcaaaaaatgtcgctactgtgatgctgtgtttcatgagcgatat
gctctcatccagcatcaaaaatcacacaaaaatgagaagcgcttcaagtgtgaccagtgt
gattatgcttgtagacaggagcggcacatgatcatgcacaagcgcactcacacgggggag
aagccttatgcctgcagccactgcgacaagaccttccgccagaaacagctcctcgacatg
catttcaagcgctatcatgatcccaactttgtccctgctgcctttgtctgttccaagtgt
gggaaaacattcacccgccggaacacaatggcaagacatgcagataactgtgctggtcca
gatggcgtagagggggaaaatggaggggagacaaagaagagcaaacgaggaagaaaaaga
aagatgcgatctaaaaaagaagactcctctgacagtgaagaaaatgctgagccggatctc
gatgacaatgaggaggaggaggagcctgctgtagaaattgaacctgagccagagcctcag
ccccagcctccgcctccacctcagcctgtggccccggcccccccacctgccaagaagaga
agggggcgacctcctggaagaaccaaccagcccaaacagaaccagccaacagccatcatt
caggtcgaagatcagaatacaggtgcaattgagaacattatagttgaagtcaaaaaggag
ccagatgccgagcctgcggagggggaagaagaggaggctcaggcagccaccacagacgcc
cccaacggagacctcacgcctgagatgatcctcagcatgatggaccggtga

DBGET integrated database retrieval system