KEGG   Mus musculus (house mouse): 13119
Entry
13119             CDS       T01002                                 
Symbol
Cyp4a14
Name
(RefSeq) cytochrome P450, family 4, subfamily a, polypeptide 14
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00071  Fatty acid degradation
mmu00590  Arachidonic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu03320  PPAR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    13119 (Cyp4a14)
   00590 Arachidonic acid metabolism
    13119 (Cyp4a14)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    13119 (Cyp4a14)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    13119 (Cyp4a14)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    13119 (Cyp4a14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    13119 (Cyp4a14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    13119 (Cyp4a14)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     13119 (Cyp4a14)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP4 family
   13119 (Cyp4a14)
SSDB
Motif
Pfam: p450 Choline_sulf_C
Other DBs
NCBI-GeneID: 13119
NCBI-ProteinID: NP_031848
MGI: 1096550
Ensembl: ENSMUSG00000028715
UniProt: O35728
Position
4:complement(115343397..115353355)
AA seq 507 aa
MGFFLFSPTRYLDGISGFFQWAFLLSLFLVLFKAVQFYLRRQWLLKTLQHFPCMPSHWLW
GHHLKDKELQQILIWVEKFPSACLQCLSGSNIRVLLYDPDYVKVVLGRSDPKASGIYQFF
APWIGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVNIMLDKWEKLDGQDHPL
EIFHCVSLMTLDTVMKCAFSYQGSVQLDENSKLYTKAVEDLNNLTFFRLRNAFYKYNIIY
NMSSDGRLSHHACQIAHEHTDGVIKMRKSQLQNEEELQKARKKRHLDFLDILLFARMEDR
NSLSDEDLRAEVDTFMFEGHDTTASGISWIFYALATHPEHQQRCREEVQSILGDGTSVTW
DHLGQMPYTTMCIKEALRLYPPVISVSRELSSPVTFPDGRSIPKGITATISIYGLHHNPR
FWPNPKVFDPSRFAPDSSHHSHAYLPFSGGSRNCIGKQFAMNELKVAVALTLLRFELLPD
PTRIPVPIARLVLKSKNGIHLCLKKLR
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgggtttttttttatttagccctacaaggtacttggatggtatctctgggttcttccaa
tgggccttcttgctcagtctatttctggtgctgttcaaggcagtccaattctacttacga
aggcagtggctgctcaagaccctccagcatttcccatgcatgccttcccactggctttgg
gggcaccatctgaaggacaaggagctccagcagattcttatatgggtagagaaattccca
agtgcctgcttacagtgtctctcggggagcaatatacgagtcctgctttatgaccctgac
tatgtgaaggtggttctggggagatcagatccaaaggcttctggaatttatcaattcttt
gctccctggattggttatggtttgctcctgttgaatgggaagaagtggttccagcatcgg
cggatgttgactccagccttccactatgatatcctcaaaccctatgtcaaaatcatggcg
gactctgtcaatataatgctagataaatgggagaagcttgatggccaggaccaccctctg
gagatcttccactgtgtttcattgatgacactggacactgttatgaagtgtgctttcagc
taccaaggcagtgttcagttggatgaaaattccaagttgtatactaaggctgtcgaggat
ctaaacaacctgactttctttcgcctgcggaatgccttttataagtacaacatcatctac
aatatgtcctctgatggacgtttgtcccaccatgcctgccagattgctcacgagcacaca
gatggagtgatcaagatgaggaagtctcagctgcagaatgaggaagagctgcagaaggcc
aggaagaagagacacttggatttcttggacatcctcttgtttgccagaatggaggatagg
aacagcttgtctgatgaggacctgcgtgcagaggtggacacattcatgtttgagggtcat
gacactacagccagtggaatttcctggattttctatgctctggccacccaccctgagcac
caacagagatgcagagaggaggtgcagagcattctgggtgatggaacctctgtcacatgg
gaccatctgggccagatgccctacaccaccatgtgcatcaaggaggccctgaggctctat
ccaccagtaatatctgtgagtcgagagctcagctcacctgtcaccttcccagatggacgc
tccatacccaaaggtatcacagccacaatttccatttatggcctacatcataacccacgt
ttctggccaaacccaaaggtgtttgacccctctagatttgcaccagattcttctcaccat
agccatgcttatctgccattctcaggaggatcaaggaactgcattgggaaacagtttgct
atgaacgagctgaaggtggctgtggccctgaccctgctccgctttgaattgctgccagat
cccaccaggatcccagtccccattgcaagacttgtgttgaagtccaagaatgggatccac
ctgtgtctcaagaagctaagataa

DBGET integrated database retrieval system