KEGG   Mus musculus (mouse): 13169
Entry
13169             CDS       T01002                                 

Symbol
Dbnl, AB, Abp1, SH3, SH3P7, mAb, mAbp1
Name
(RefSeq) drebrin-like
  KO
K20520  drebrin-like protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    13169 (Dbnl)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    13169 (Dbnl)
SSDB
Motif
Pfam: Cofilin_ADF SH3_9 SH3_1 SH3_2 DBINO
Other DBs
NCBI-GeneID: 13169
NCBI-ProteinID: NP_001139780
MGI: 700006
Ensembl: ENSMUSG00000020476
Vega: OTTMUSG00000005097
UniProt: Q62418
Position
11 A1; 11 3.87 cM
AA seq 436 aa
MAVNLSRNGPALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEELVEELNSG
KVMYAFCRVKDPNSGLPKFVLINWTGEGVNDVRKGACANHVSTMANFLKGAHVTINARAE
EDVEPECIMEKVAKASGANYSFHKESTSFQDVGPQAPVGSVYQKTNAISEIKRVGKDNFW
AKAEKEEENRRLEEKRRAEEERQRLEEERRERELQEAARREQRYQEQHRSAGAPSPSSRT
GEPEQEAVSRTRQEWESAGQQAPHPREIFKQKERAMSTTSVTSSQPGKLRSPFLQKQLTQ
PETSYGREPTAPVSRPAAGVCEEPAPSTLSSAQTEEEPTYEVPPEQDTLYEEPPLVQQQG
AGSEHIDNYMQSQGFSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGP
DGHFGMFPANYVELIE
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggcggtgaacctgagccggaacgggccggcgctgcaggaggcctacgtgcgcgtagtc
accgagaaatccccgaccgactgggctctttttacctatgaaggcaacagcaatgacatc
cgtgtggctggcacaggagagggaggcctggaggagctggtggaagagctcaacagcggg
aaggtgatgtacgccttctgcagggtgaaggaccccaactccggcctgcccaagtttgtc
ctcatcaactggacaggagagggtgtgaatgatgtgcggaaaggagcatgtgccaaccac
gtcagcaccatggccaacttcctgaagggtgcccacgtgaccatcaatgcccgggccgag
gaggatgtggagcctgagtgcatcatggagaaggttgccaaggcctctggggccaactac
agcttccataaggaaagcacctccttccaggatgtagggccgcaggccccagtgggctct
gtgtaccagaagaccaatgccatatctgagatcaagagagtcggcaaggataacttctgg
gccaaagctgagaaggaagaagagaaccgccgcctggaggagaagcggcgtgccgaagag
gagcggcagcggttggaggaggagcgacgagagcgggagctgcaggaggctgcccgacgt
gagcagcgctaccaggaacagcacagatcagctggagccccgagcccttccagcaggaca
ggtgagccagagcaggaagccgtttcaaggaccagacaggagtgggagtctgctgggcag
caggccccacacccacgagagattttcaagcagaaggaaagggcaatgtccaccacctct
gtcaccagctcgcagccgggcaagctgaggagccccttcctgcagaagcaactcactcaa
ccagaaacctcctacggccgagagcccacagctcctgtctcccggcctgcagcaggtgtc
tgtgaggagccagcgcctagcactctgtcttctgcccagacagaagaagaacctacatat
gaagtacccccagagcaggacaccctctatgaggaaccaccactggtacagcagcaaggg
gctggctccgaacacattgacaactacatgcagagccagggcttcagtggacaagggctg
tgcgcccgggccttgtatgactaccaggcagctgatgacaccgagatctcctttgaccct
gagaacctaatcacaggcatcgaggtgattgacgaaggctggtggcgaggctatgggcct
gacggccactttggcatgtttcctgccaactacgtggagctcatagagtga

DBGET integrated database retrieval system