KEGG   Mus musculus (house mouse): 13206
Entry
13206             CDS       T01002                                 
Symbol
Ddx4, Mvh, VASA
Name
(RefSeq) DEAD box helicase 4
  KO
K13982  probable ATP-dependent RNA helicase DDX4 [EC:3.6.4.13]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    13206 (Ddx4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     13206 (Ddx4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    13206 (Ddx4)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 13206
NCBI-ProteinID: NP_034159
MGI: 102670
Ensembl: ENSMUSG00000021758
UniProt: Q61496
Structure
Position
13:complement(112734867..112790342)
AA seq 702 aa
MGDEDWEAEILKPHVSSYVPVFEKDKYSSGANGDTFNRTSASSDIGESSKKENTSTTGGF
GRGKGFGNRGFLNNKFEEGDSSGFWKESNNDCEDNQTRSRGFSKRGGCQDGNDSEASGPF
RRGGRGSFRGCRGGFGLGRPNSESDQDQGTQRGGGLFGSRKPAASDSGNGDTYQSRSGSG
RGGYKGLNEEVVTGSGKNSWKSETEGGESSDSQGPKVTYIPPPPPEDEDSIFAHYQTGIN
FDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRD
LMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARK
FSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDE
ADRMLDMGFGPEMKKLISCPGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQ
VGGACRDVQQTILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKIST
TSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHR
IGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPSFSSS
TRGGAVFASVDTRKNYQGKHTLNTAGISSSQAPNPVDDESWD
NT seq 2109 nt   +upstreamnt  +downstreamnt
atgggagatgaagattgggaggcagaaatactcaaacctcacgtgtcttcctatgttcct
gtatttgagaaggataaatattcttctggagcaaatggagacacttttaacaggacttca
gcttcatcagatattggcgagtctagtaaaaaagagaacacatctacaactggtggcttt
ggaagaggaaagggctttggaaacagaggttttttaaataacaagtttgaagaaggtgat
agctctggtttctggaaagagtctaataatgactgtgaagataatcagactcgaagcaga
gggttttccaagcgaggtggctgccaagatggaaacgattcagaagcatcaggcccgttc
agaagagggggaagaggcagtttccgaggctgccgtggaggatttggtctaggaagacca
aatagtgaatctgaccaagatcaggggacacagcgtggtggtggcctttttggttctagg
aaaccagcagcaagtgattcaggcaatggtgacacttaccaaagcagaagtggaagtggt
cgaggtggttacaaaggtttaaatgaagaagtagtaacaggttctggaaagaattcttgg
aagtcagaaactgaaggaggtgaaagcagtgatagtcaaggtccaaaagtgacatatata
ccccctcctccaccagaggatgaggactccatctttgcacattatcagacaggcataaac
tttgataaatatgacaccatacttgttgaagtatctggacatgatgcaccaccggcaatt
ttgacttttgaagaagctaatctctgtcagacactgaataacaacattgctaaagctggc
tatactaagcttactcctgtgcagaagtacagcattcccattgtattagcaggacgagat
ttgatggcttgtgctcaaacagggtctgggaagactgcagcttttctcttgcctattttg
gctcatatgatgcgggatggaataactgccagtcgctttaaagaactgcaggaaccagag
tgtattattgtagcaccaactcgagaactgatcaaccaaatttacttggaagccagaaaa
ttttcttttgggacttgtgtaagagctgtggtcatatatggaggaacccagtttggtcat
tcagttcgacagatagtacaagggtgtaacatattgtgtgctactccagggaggctgatg
gacatcataggcaaagaaaagattggcctcaaacaagtcaagtacttagttttggatgaa
gctgatcgaatgttggatatgggttttggaccagagatgaagaaactaatttcttgtcca
ggaatgccatcaaaggaacaacgccaaacccttttattcagtgctacttttccagaagaa
atccagaggttggctggggactttctaaagtccagttacttgtttgtcgctgttgggcaa
gtgggaggagcttgcagagatgttcagcagacgatccttcaagttggccagtattcaaaa
agagaaaagcttgttgagattctacgaaacataggtgatgaaagaactatggtctttgtt
gaaaccaagaaaaaagccgatttcattgcaacttttctttgtcaagaaaaaatatcaact
acaagtattcatggtgatcgggagcagagggagagagagcaagctcttggagattttcgc
tgtggaaagtgcccagttcttgttgctacttcagtggctgccagagggcttgatattgaa
aatgttcaacatgttatcaattttgaccttccttctaccattgatgagtatgttcatcga
attggacgcactggccgctgtggaaatactggcagagcgatttctttttttgatactgac
tctgataatcatttagcacagcctctagttaaagtactgtcagacgctcaacaggatgtc
cccgcatggctagaagagattgccttcagtacctatgtgcctcccagcttcagtagcagc
acaagagggggggctgtgtttgcatctgttgacacgaggaagaattaccagggcaagcac
acgttgaatacagcggggatttcttcttcacaagctcccaatccagttgatgacgagtca
tgggattaa

DBGET integrated database retrieval system