KEGG   Mus musculus (house mouse): 13207
Entry
13207             CDS       T01002                                 
Symbol
Ddx5, 2600009A06Rik, G17P1, HUMP68, Hlr1, p68
Name
(RefSeq) DEAD box helicase 5
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:3.6.4.13]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03040  Spliceosome
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    13207 (Ddx5)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    13207 (Ddx5)
   05205 Proteoglycans in cancer
    13207 (Ddx5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    13207 (Ddx5)
   03009 Ribosome biogenesis [BR:mmu03009]
    13207 (Ddx5)
Spliceosome [BR:mmu03041]
 Complex A
  U1 snRNP components
   U1 related factors
    13207 (Ddx5)
 Complex B
    13207 (Ddx5)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    13207 (Ddx5)
SSDB
Motif
Pfam: DEAD Helicase_C P68HR ResIII Helicase_C_2 ERCC3_RAD25_C BNIP2
Other DBs
NCBI-GeneID: 13207
NCBI-ProteinID: NP_001342605
MGI: 105037
Ensembl: ENSMUSG00000020719
Position
11:complement(106671181..106680011)
AA seq 615 aa
MSSYSSDRDRGRDRGFGAPRFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQ
EHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAI
QAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELA
QQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLR
RTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHI
NIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRK
MRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGS
GRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSNLLKRDFGAKTQNGVYSAANY
TNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVANMHNGMNQQAYAYPATAA
AAPMIGYPMPTGYSQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgtcgagttattctagtgaccgagaccgcggccgggatcgagggtttggtgcacctcga
tttggagggagtagaacaggacccctctctggaaagaagtttggaaatcctggggagaaa
ctagttaaaaagaagtggaatcttgatgagctgcccaaatttgagaagaatttttatcaa
gaacaccctgatttggcaaggcgcaccgcacaagaggtagatacatacagaagaagcaag
gaaattacagttagaggtcacaactgtccaaaacctgttctgaatttttatgaagcaaac
tttcctgcgaatgtcatggatgtgattgcaaggcagaactttactgaacccactgctatt
caagctcagggctggccagttgctctcagtggattggatatggttggagtagctcagact
ggatctgggaaaacattatcttatttgctgcctgccattgtacacataaaccaccagcca
ttcctagagagaggtgatgggcctatttgcttggtgctggcaccaactcgagaactggca
cagcaggtgcagcaagtggctgctgaatattgtcgagcttgtcgcttgaagtctacttgc
atctatggtggtgctcccaaaggaccacagattcgtgatttggaaagaggtgtggaaatc
tgtattgcaacacctggaagactgattgactttttagagtgtgggaaaaccaatctgaga
agaacaacttaccttgtccttgatgaagctgataggatgcttgatatgggatttgaaccc
cagataaggaaaattgtggatcaaataagacctgataggcaaacactaatgtggagtgca
acttggccaaaagaagtaagacagcttgctgaagatttcctgaaagactatattcatatc
aatattggtgcactggaactgagtgcaaaccataacattcttcagattgtggatgtatgt
catgatgtcgaaaaggatgaaaagcttattcgtctgatggaagaaatcatgagtgagaag
gagaataaaactattgtttttgttgaaaccaaaagaagatgtgatgaacttaccagaaaa
atgaggagagatgggtggcctgccatgggcatccatggtgacaagagtcagcaggaacgt
gactgggttctaaatgaattcaaacatggaaaagctcctattctgattgctaccgatgtg
gcctccagagggctagatgtggaagatgtgaaatttgtcatcaattatgactaccctaac
tcctcagaggattatattcatcgaattggaagaactgctcgcagtaccaaaacaggcaca
gcatacactttctttacacctaataacataaagcaagtgagcgaccttatctctgtgctt
cgggaagctaatcaagcaattaatcccaagttgcttcagttggtcgaagacagaggttca
ggtcgttccaggggtagaggaggcatgaaggacgatcgtcgtgacagatactctgcaggc
aaaaggggtggatttaatacctttagagacagggaaaactatgacagaggctactctaat
ctgcttaagagagattttggggctaaaactcagaatggtgtttacagtgctgcaaattac
accaatgggagctttggaagtaattttgtatctgctggcatacagaccagttttaggact
ggtaatccaacagggacttaccagaacggttatgatagcactcagcaatatggaagtaat
gttgcaaatatgcacaatggtatgaaccaacaggcatatgcatatcctgctaccgcagct
gctgcgcctatgattggctatcccatgccaacagggtattctcaataa

DBGET integrated database retrieval system