KEGG   Mus musculus (mouse): 13848
Entry
13848             CDS       T01002                                 

Symbol
Ephb6, Cek, Cekl, Me, Mep
Name
(RefSeq) Eph receptor B6
  KO
K05114  Eph receptor B6 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13848 (Ephb6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    13848 (Ephb6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13848 (Ephb6)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   13848 (Ephb6)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_2 EphA2_TM SAM_1 Ephrin_rec_like Pur_ac_phosph_N Phage_holin_5_1
Other DBs
NCBI-GeneID: 13848
NCBI-ProteinID: NP_001139823
MGI: 1096338
Ensembl: ENSMUSG00000029869
Vega: OTTMUSG00000035976
UniProt: O08644
Position
6; 6 B2.1
AA seq 1014 aa
MATEGTTGSGSRVVAGMVCSLWLLVLGSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEV
SVLDDQRRLTRTFEACHVAGLPPGSGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGV
SGGTCRETFTLYYRQADEPDGPDSIAAWHLKRWTKVDTIAADESFPASSSSSSWAVGPHR
TGQRVGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVKLFSYTCPSVLRAFASFPET
QASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGRWMVAVGGCRCQPGH
QPARGDKLCQACPEGSYKALAGNVPCSPCPARSHSPDPAAPVCPCLQGFYRASSDPPEAP
CTGPPSAPRELWFEVQGSALMLHWRLPQELGGRGDLLFNVVCKECGGHGEPSSGGMCRRC
RDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEV
PSAVPVMHQVSRAANSITVSWPQPEQTNGNILDYQLRYYDQAEDESHSFTMTSETNTATV
TRLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPEKLSLVIGSILGALAFL
LLAAITVLAVIFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYDDPCQAIRELAREVDP
TYIKIEEVIGAGSFGEVRRGRLQPRGRREQAVAIQALWAGGAESLKMTFLGRAALLGQFQ
HPNILRLEGVVTKSRPVMVLTELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLS
SFAFVHRALSARSVLVNSHLVCKVARLGHSPQGSSSLLRWAAPEVITHGKYTTSSDVWSF
GILMWEVMSYGERPYWDMNEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPH
FDQLVAAFDKMIRKPDTLQAEGGSGDRPSQALLNPVALDFPCLDSPQAWLSAIGLECYQD
NFSKFGLSTFSDVAQLSLEDLPGLGITLAGHQKKLLHNIQLLQQHLRQPGSVEV
NT seq 3045 nt   +upstreamnt  +downstreamnt
atggctactgagggcacgactggctcagggagcagagtggtggcgggcatggtgtgcagt
ctgtggctcctggttctagggtcatcagttctagctctggaagaggtgctgctggatacc
acaggagagacctctgagattggctggctcacctacccgccaggtgggtgggatgaggtg
agtgttctagatgaccagcgccgtctgactcggaccttcgaagcatgccacgttgcaggg
ctccctcctggttctggccaggacaattggctgcagacacactttgtggaacggcgaggg
gcccagagggcacacatccgccttcacttctctgtacgagcctgttccagcctgggtgtg
agtgggggtacctgccgagagaccttcaccctttactaccggcaggctgatgagccagac
ggccccgacagtattgcggcctggcacctcaaacgctggaccaaagtggacacaattgcc
gcagatgagagcttccctgcctcctcttcctcttcctcatgggctgtgggaccccacagg
accggtcagcgggtgggactgcagctgaatgtcaaagagcgcagctttggtcctctcact
cagcgtggcttctatgtggccttccaggacacaggggcctgcctggcccttgtggcagtc
aagctcttctcctacacctgtccctccgtcctgcgtgcctttgcctcttttcctgagaca
caggccagtggagctggaggggcttccttagtggcagctgtgggcacctgtgtagctcat
gcagaaccagaggaggatggagtaggaggccaggcagggggcagccccccaaggttacac
tgtaatggcgaaggcaggtggatggtagctgtgggaggctgccgctgccagcctggacac
cagcctgctcgtggagacaagctctgccaagcctgccctgagggatcctataaggccctg
gctgggaatgttccctgttcaccgtgtccagcccgcagccactcccctgaccctgcagcc
ccagtttgcccatgtctccaaggcttctacagggccagttcggacccaccagaggctccc
tgcactggtcctccatcggctccccgggagctatggtttgaggtgcaaggctcggcactc
atgctgcactggcgtctgcctcaggagctgggtggacgaggggatctgctcttcaatgtt
gtgtgcaaggagtgtggaggtcacggagagcccagcagtggggggatgtgtcgccgctgc
agggacgaggtgcatttcgacccccgccagaggggactgactgagagtcgagtgttagtt
ggggggctccgagcacacgtgccatacatcttggaagtgcaggctgtcaatggggtgtct
gagctcagccctgaccctccccaggcagcagccatcaatgtcagcaccagccacgaagtc
ccttctgcagtccctgtgatgcaccaggtgagccgggcagccaacagcatcacagtatcc
tggccacagcctgagcaaacaaatgggaacatcctcgactaccagctgcgctactatgac
caggcagaagatgaatcccactccttcaccatgaccagtgagaccaacactgccactgtg
acacggttgagccctggccacatctatggcttccaggtgcgggcacggactgcagctggc
cacggcccctatgggggcaaagtctattttcagacattgcctcaaggtgagctgtcctcc
cagcttccagagaagctgtccttggtgattggttccatcctgggggccttggccttcctt
ctactggcagccatcactgtactggctgtcatcttccagcggaagcgccgtgggaccggc
tacacagaacaactgcaacaatacagcagcccaggacttggagtgaagtattacattgac
ccttctacatacgatgacccctgccaggccatcagagagcttgctcgagaggttgaccct
acatatatcaagattgaagaagtcattggggcaggttcctttggagaagtgcgtcggggc
cgactgcaaccccggggaaggagggaacaagctgtggctatccaggccttgtgggcaggg
ggtgctgagagcctgaagatgacctttctgggtcgggcagcactgctgggccagttccag
caccccaatatcctgcggctggaaggtgtagtcactaagagtcggcctgtcatggtgctg
acagaactcatggaacttggtcccctggacagctttcttaggcagcgagagggccagttc
agtagcctgcagctggtggccatgcagcggggtgtggctgctgccatgcagtacttgtcc
agctttgcctttgttcaccgagcactctcggcccgaagtgtgctagtgaatagccacctg
gtgtgtaaggtggcacgtctcggccacagtcctcagggttcaagttccttgcttcgctgg
gcagccccagaggtcattacacatggaaagtatacaacatctagcgatgtctggagcttt
ggcatactcatgtgggaagtgatgagctatggagaacggccctactgggacatgaacgag
caggaggtactaaatgcaatagagcaagagttccggctgcccccacctccagggtgcccc
cctggactacatctactgatgctagacacttggcagaaggaccgtgcccgtcggcctcat
tttgaccagctggtagctgcatttgacaagatgattcgcaagcctgatactctccaggct
gaagggggctccggggacaggccttcccaggctcttctgaaccctgtggccttggacttc
ccttgcctggactctccccaggcctggctttcagccattggactagagtgctaccaggac
aacttctccaagtttggtctttccaccttcagtgatgtggctcagctcagcctggaagac
ctgccaggcctgggcatcaccctagctggccaccagaagaaacttctgcacaacattcag
ctcctccagcagcacctgaggcagccaggctcagtggaagtgtaa

DBGET integrated database retrieval system