KEGG   Mus musculus (mouse): 14013
Entry
14013             CDS       T01002                                 

Gene name
Mecom, D630039M04Rik, Ev, Evi, Evi-1, Evi1, Jb, Jbo, MDS1-E, Mds, Mds1, Mds1-Evi1, Prd, Prdm3, ZNFPR, Znfpr1b1
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
mmu04010  MAPK signaling pathway
mmu05200  Pathways in cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    14013 (Mecom)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14013 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14013 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    14013 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14013 (Mecom)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14013 (Mecom)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     14013 (Mecom)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    14013 (Mecom)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     14013 (Mecom)
SSDB
Other DBs
NCBI-GeneID: 14013
NCBI-ProteinID: NP_067417
MGI: 95457
Ensembl: ENSMUSG00000027684
Vega: OTTMUSG00000038143
UniProt: P14404
Position
3 A3; 3 12.66 cM
AA seq 129 aa
MRSKGRARKLATSNECAYGNYPEIPLEEMPDADADGITSVPSLHIQEPCSPATSSESFTP
KEGSPYKAPIYIPDDIPIPDEFELRESTMPGAGLGIWTKRKIEIGEKFGPYMGEQRSDLK
DSSYGWENR
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagatccaaaggcagggcaaggaaactggccacaagtaatgagtgtgcctatggcaac
tatcctgaaatacctttggaagaaatgccagatgctgatgcagatgggataaccagtgtt
ccctccctccacattcaagagccatgctctcctgcgacgtccagtgagtcatttactcct
aaggagggctcgccatacaaagctcccatctacatccctgatgacatccctattcctgat
gagtttgagcttcgagagtcaactatgcctggagcaggacttggaatatggaccaaaagg
aagattgaaataggcgaaaagtttgggccatacatgggagagcagagatcagacctgaaa
gattccagctatggatgggagaacaggtga

DBGET integrated database retrieval system