KEGG   Mus musculus (house mouse): 14137
Entry
14137             CDS       T01002                                 
Symbol
Fdft1, SQS, SS
Name
(RefSeq) farnesyl diphosphate farnesyl transferase 1
  KO
K00801  farnesyl-diphosphate farnesyltransferase [EC:2.5.1.21]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00100  Steroid biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    14137 (Fdft1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mmu01006]
    14137 (Fdft1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.21  squalene synthase
     14137 (Fdft1)
Prenyltransferases [BR:mmu01006]
 Terpene biosynthesis
  Squalene/phytoene synthase
   14137 (Fdft1)
SSDB
Motif
Pfam: SQS_PSY
Other DBs
NCBI-GeneID: 14137
NCBI-ProteinID: NP_034321
MGI: 102706
Ensembl: ENSMUSG00000021273
UniProt: P53798
Position
14:complement(63382599..63419136)
AA seq 416 aa
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQA
LDGDIRHAICVFYLVLRALDTVEDDMSISVEKKIPLLCNFHTFLYDPEWRFTESKEKDRQ
VLEDFPTISLEFRNLAEKYQTVIDDICHRMGCGMAEFVDKDVTSKQDWDKYCHYVAGLVG
IGLSRLFSASEFEDPIVGEDIECANSMGLFLQKTNIIRDYLEDQQEGRKFWPQEVWGRYI
KKLEDFAKPENVDVAVQCLNELITNTLQHIPDVLTYLSRLRNQSVFNFCAIPQVMAIATL
AACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRIPNSDPSSSKTK
QVISKIRTQNLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggagttcgtcaagtgtctaggccacccggaggagttctataacctgctgcgattccgc
atgggaggccggcggaattttatacccaagatggaccaggactcactcagcagcagcttg
aagacctgctacaagtatctcaatcagaccagtcgcagctttgccgcggttatccaggcg
ctggatggggacatacggcacgccatatgtgtgttctacctggttctccgagccctggat
acagtggaggatgacatgagcatcagtgtggagaagaagatcccactgctgtgtaacttc
cacactttcctctatgacccagagtggcggttcactgagagcaaggagaaggaccgacaa
gtgctggaggacttccccacgatctccctggagtttagaaatttggctgagaaatatcaa
acagtgatcgatgacatctgccaccggatggggtgtgggatggcagaatttgtagacaag
gatgtgacctccaaacaggactgggacaagtactgccactacgttgctgggctggtggga
attggcctttctcgtctattctctgcctcagagtttgaagaccccatagttggtgaagac
atagagtgtgccaactcaatgggtctgttcctgcagaaaacaaatatcattcgtgattat
ctggaagaccaacaggaaggaaggaagttttggcctcaggaggtgtggggcagatacatt
aagaagttggaagactttgctaagccagagaacgtagatgtggccgtgcagtgcttgaat
gaactcataaccaacaccctacagcacatccctgacgtcctcacctacctgtcaaggctc
cggaaccagagtgtgtttaacttctgtgctattccacaggtaatggccattgccacactg
gctgcctgttacaataaccagcaggtattcaaaggagtagtgaagattcggaaggggcaa
gcagtcaccctcatgatggatgccaccaacatgcctgccgtcaaagctatcatataccag
tacatagaagagatttatcaccggatccccaactcagacccatcatcaagcaaaaccaag
caggtcatctccaagatcaggacacagaaccttcccaactgccagctcatctcccgaagc
cactactcccccatttacctgtcatttatcatgctcttggctgccctgagctggcagtac
ctgagcaccctgtcccaggtcacagaagactatgtccagagagaacactga

DBGET integrated database retrieval system