KEGG   Mus musculus (mouse): 14154
Entry
14154             CDS       T01002                                 

Symbol
Fem1a, AW611390, Eprap, Fem1aa
Name
(RefSeq) fem 1 homolog a
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 TPR_12 TPR_2 Peptidase_C107 TPR_10
Other DBs
NCBI-GeneID: 14154
NCBI-ProteinID: NP_034322
MGI: 1335089
Ensembl: ENSMUSG00000043683
UniProt: Q9Z2G1
Position
17 D; 17 29.24 cM
AA seq 654 aa
MDLHTAVYNAAHDGKLPLLQKLLAGRGREELEELLGEVAGGGTPLLIAARRGHLDVVEYL
VDHCGASVEASGSVHFDGETIEGAPPLWAASAAGHLAVVRSLLRRGASVNRTTRTNSTPL
RAACFDGHLDVVRYLVGEHKADLEVANRHGHTCLMISCYKGHREIARYLLERGAQVNRRS
AKGNTALHDCAESGSLEILQLLLGCHARMERDGYGMTPLLAASVTGHTNIVEYLIQEQPG
HEQLSGTELPGEGSSQVAGNHCSTPEEAEPYESCCPTSREAAVEALELLGATYVDKKRDL
LGALKHWRRAMELRHQGGGYLPKPEPQQLVLAYDYSREVTTPQELEALITDPDEMRMQAL
LIRERILGPSHPDTSYYIRYRGAVYADSGNFERCIRLWKYALDMQQNNLEPLSPMTASSF
LSFAELFSYVLQDRSAKGNLGMQLGFADLMGVLSKGVREVERALQLPKEPGDSAQFTKAI
AIILHLLYLLEKVECTPSQEHLKHQTVYRLLKCAPRGKNGFTPLHMAVDKETTNVGRYRV
GVFPSLQVVKVLLDCGADPDSRDFDNNTPLHIAAQNNCPAIMDALIEAGAHMDATNAFKK
TAYELLDSKLLAKSTVQPFNYVTLQCLAARALDRNKVPYKGFIPEELEAFIQLH
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggatctgcacacagcggtgtacaatgcggcgcacgacggcaagctgccgctgctgcag
aagctgctggccggccgtgggcgtgaggagctggaggagctgctgggtgaggtggccggc
ggtggcacgccactgctaatcgcagcgcgccgtggacacctagacgtggtggagtatctg
gtggaccactgcggcgccagcgtggaggcgagcggctccgtgcacttcgatggcgagacc
atcgagggcgcgccgccgctctgggcagcgtcggccgcgggtcacctggccgtggtgcgt
agccttctgcgccgaggcgcctcggtcaaccgcaccacgcgcaccaactccacgccgctg
cgcgccgcctgcttcgacggccacctggacgtggtacgctacctggtgggcgagcacaag
gcggacctggaggtggccaatcgccacggccacacgtgccttatgatctcctgctacaag
ggccaccgcgagatcgcgcgctacctgctggagcgcggcgcacaggtgaaccggcgcagc
gccaagggcaacaccgccctgcacgactgtgcagaatctggcagcctggagatcctacag
ctgctgctgggctgccacgcgcgcatggagcgcgacggctatggcatgaccccgctgctg
gccgccagcgtcaccgggcacaccaacatcgtggagtacctcatccaggaacagccgggc
cacgagcagctctcagggacagagcttcccggggaaggctcctcccaggtggcaggaaac
cactgctccaccccagaagaagcagaaccgtatgagagctgctgccctaccagccgggaa
gcagctgtggaagctttggagctgctgggtgccacctacgtggataagaaaagggatctg
cttggagccctgaagcactggagaagggcgatggaactccgtcaccagggtggaggctac
ctccctaagccggagccccagcaactggttctggcctatgactattccagggaggtgact
acaccccaagagttggaagccctcattacagatcctgatgaaatgcggatgcaggcgctg
ctgatacgggagagaatcttgggcccctcacatcctgacacttcatactacatacggtac
cggggtgctgtctatgcggactccgggaatttcgagcgctgtatccgtctgtggaagtat
gccttggacatgcaacaaaacaacttggagcccctgagccccatgaccgccagcagcttc
ctgtcgtttgcagagctcttctcctacgtgctgcaggaccgctcggccaagggcaacctg
ggcatgcagcttggctttgccgacctcatgggtgtgctcagcaaaggggttcgggaagtg
gagcgggctctgcagttgcccaaggaaccgggtgactccgcacagttcaccaaagccatt
gccatcatcctccaccttctgtacctattggagaaggtggagtgcacccccagccaggaa
cacctcaagcaccagacagtctaccgcctgctcaagtgtgcccctcgcggtaaaaacggc
ttcaccccactacacatggcggtggacaaggagaccaccaacgtgggccggtatcgtgtg
ggcgtcttcccatcgctgcaggtggtcaaggtgctgttggactgcggagcagaccctgac
agcagggatttcgacaacaacaccccactgcacatcgctgcccagaataattgcccggcc
atcatggatgctctcatcgaagctggggcccacatggacgccaccaatgccttcaaaaag
actgcctacgagctgctggactcgaagctgttggctaagagcaccgtgcagcctttcaat
tatgtgacactgcagtgcctagctgcccgtgccctggacaggaacaaggtcccttataag
ggcttcatcccagaggagctggaggccttcatccagttgcattga

DBGET integrated database retrieval system