KEGG   Mus musculus (mouse): 14633
Entry
14633             CDS       T01002                                 

Gene name
Gli2
Definition
(RefSeq) GLI-Kruppel family member GLI2
  KO
K16798  zinc finger protein GLI2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04390  Hippo signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    14633 (Gli2)
   04390 Hippo signaling pathway
    14633 (Gli2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14633 (Gli2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    14633 (Gli2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14633 (Gli2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    14633 (Gli2)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 14633
NCBI-ProteinID: NP_001074594
MGI: 95728
Ensembl: ENSMUSG00000048402
Vega: OTTMUSG00000034815
UniProt: Q0VGT2 A5AA27 Q8BKI7
Position
1 E2.3; 1 52.17 cM
AA seq 1544 aa
METSAPAPALEKKEAKSGLLEDSSFPDPGKKACPLAVAAAVAAHGVPQQLLPAFHAPLPI
DMRHQEGRYHYDPHSVHSVHGPPTLSGSPVISDISLIRLSPHPAGPGESPFSAHHPYVNP
HMEHYLRSVHSSPTLSMISAARGLSPADVAHEHLKERGLFSLAAPGTNPSDYYHQMTLMA
SHPTPYGDLLMQSGGAASAPHLHDYLNPVDASRFSSPRVTPRLSRKRALSISPLSDASLD
LQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQILSQQR
GLGSAFGHTPPLIQPSPTFLAQQPMTLTSISTMPTQLSSSSSNCLNDANQNKQNSESAVS
STVNPITIHKRSKVKTEAEGLRPASPLGLTQEQLADLKEDLDRDDCKQEAEVVIYETNCH
WADCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGE
KPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSN
EKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHVRAPLLKENGDNEASA
EPGGRGPEESVEASSTSHTVEDCLHIKAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNN
DSGMEMPGTGPGSLGDLTALADTCPGADTSALAAPSTGGLQLRKHMSTVHRFEQLKREKL
KSLKDSCSWAGPAPHTRNTKLPPLPVNGSVLENFNNTGGGGPAGLLPSQRLPELTEVTML
SQLQERRDSSTSTMSSAYTVSRRSSGISPYFSSRRSSEASPLGGLRPHNASSADSYDPIS
TDASRRSSEASQCSGGGPGLLNLTPAQQYNLRAKYAAATGGPPPTPLPGLDRVSLRTRLA
LLDAPERALPGACPHPLGPRRGSDGPTYSHGHGHGYAGAAPAFPHEGPNSSTRRASDPVR
RPDPLILPRVQRFHSTHNMNPGSLPPCADRRGLHVQSHPSVDSNLTRNAYSPRPPSINEN
VVMEAVAAGVDGPGLECDLGLVEDELVLPDDVVQYIKAHTGGTLDDGIRQGYPTEGTGFP
ENSKLPSPGLQGHRRLAAADSNMGPSAPGLGGCQLSYSPSSNLNKSNMPVQWNEVSSGTV
DALPTQVKPPPFPHSNLAVVQQKPAFGQYPGYNPQSVQSSSGGLDSTQPHLQLRGAPSAS
RGSYTQQPRQPAAGSQCLGMSAAMSPQASYSQAHPQLSPNIVSGSLNQFSPSCSNMAAKP
SHLGLPQQMEVVPNATIMNGHQREHGVPNSSLAAVSQPHPVLSYPQQDSYQQGSNLLSSH
QPGFMESQQNAGFGLMQPRPPLEPNTASRHRGVRSGQQQLYARTTGQAMVTSANQETAEA
MPKGPAGTMVSLAPQPSQDTGRAQDQNTLYYYGQIHMYEQNGGCPAVQPQPPQPQACSDS
IQPEPLPSPGVNQVSSTVDSQLLEPPQIDFDAIMDDGDHSSLFSGALSPTLLHNLSQNSS
RLTTPRNSLTLPSIPAGISNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4635 nt   +upstreamnt  +downstreamnt
atggagacttctgccccagcccctgcactggagaagaaagaagccaagagtggtctcttg
gaggacagcagcttccccgacccagggaaaaaggcctgtcctctggcggtggccgcagct
gtagccgcccacggagttcctcagcagctcctgccggctttccacgcgcctttgccgatt
gacatgagacaccaggagggaaggtaccattatgaccctcactctgtccacagtgtacac
gggcctcccaccctaagtggcagccctgtcatctcagatatctccttgatacgactttct
ccacaccctgctggccctggagagtcacccttcagcgcccaccacccctacgtgaacccc
catatggagcactacctccggtctgtgcacagcagccccacactctcaatgatctctgcc
gccaggggcctcagccctgctgatgtggcccacgaacatctgaaagagaggggactcttt
agcctcgcagccccaggcaccaacccttcagactattaccaccagatgaccctcatggca
agccaccccaccccttatggggaccttctaatgcagagcgggggtgctgctagcgcaccc
catctccatgactacctcaaccctgtggatgcatcacgattctctagtccacgtgtgacc
ccacgactgagccgcaagcgggctctgtccatctccccgctctcagatgccagcctcgac
ctacaacgcatgattcggacctctcccaactcgctggtagcttacatcaacaactccagg
agcagctcagcagccagtggctcttatggacatctgtctgctggtgccctcagcccagcc
ttcacttttccccaccccatcaatcctgtggcctaccagcagatcctgagccagcagcgg
ggcctgggctcagcctttggacacacaccacccctgatccagccttcacccaccttcttg
gcccagcagcccatgactctcacctccatcagcaccatgcctacccaactcagcagcagt
agcagcaactgtctaaatgatgccaaccagaacaagcagaacagcgagtcagctgtgagc
agcaccgtgaaccccatcaccattcataagcggagcaaggtcaagactgaggctgagggc
ctgcgtccagcatccccgcttggactgacacaggagcagctggccgatctcaaggaagac
ctggacagggatgactgtaagcaggaggccgaggtggtcatctacgagaccaactgccac
tgggcagactgcaccaaggagtatgacacacaggagcagctggtgcatcatatcaacaat
gaacacatccacggggagaagaaggagttcgtgtgccgctggcaggcctgcacgagagag
cagaagcccttcaaggcccagtacatgctggttgttcacatgcgcagacacacgggtgag
aagccacacaagtgcacgttcgaaggctgttccaaggcctactctcgcctggagaacctg
aagacacacctgcgttcacacacaggagagaagccatatgtgtgtgaacacgaaggctgt
aacaaagccttctccaatgcctcagaccgcgccaagcaccagaaccgcactcactccaat
gagaaaccctacatctgcaagatcccaggctgcaccaagaggtacacagaccccagctca
ctccgcaagcatgtgaagactgtccatgggccagacgcccatgtcaccaagaaacagcgt
aatgatgtgcatgtccgtgctccactgctcaaggagaatggggataatgaggccagcgcc
gagccaggtggccggggacctgaggagagtgtggaggccagtagcaccagccacactgtg
gaggactgcctacatatcaaagccatcaagacagagagctccgggctttgtcagtccagc
cccggggcccagtcatcctgcagcagcgagccctctcccctgggcagtgcccccaacaat
gacagtggcatggagatgccggggacagggcctgggagtctgggagacctgacagcactg
gctgacacgtgtccaggagctgacacctcagccctggctgcaccctccactggtggcctg
cagctgcgcaaacacatgagcaccgtgcatcgctttgagcagctgaagagagagaagctc
aagtcactgaaggattcctgctcgtgggccggcccagctccacacacccgcaacaccaag
ctgcctccccttccagtcaatggttctgtcctggaaaacttcaacaatacagggggcggt
ggaccggcaggactgctgcccagccagcggctaccagagctgaccgaagtgacgatgctg
agccagctgcaggaacgaagagacagctccaccagcaccatgagctcggcctacactgtg
agccgccgctcctctggcatctccccatacttctctagccgtcgctccagcgaggcttcg
cctctcggtggcctacgcccgcacaacgccagctcagcagactcctatgaccccatctcc
acagatgcctctcggcgctccagtgaagccagccagtgcagtggcggtggcccagggctg
ctcaacctcacacctgcgcagcagtacaacctgcgtgccaagtacgcagcggccacaggt
ggaccaccgcccacgccactgccgggcctcgatcgtgtaagccttcgtacccgcctggcc
ttgctggatgctcctgagcgtgcacttcctggtgcctgcccacatccactggggccacgg
cgtggcagcgatgggcctacctatagccatggtcatggccatggctacgcaggtgcggct
ccagcattcccccacgaggggccaaacagcagcacacggcgggccagcgaccctgtgcgg
cgccctgacccccttattctgcctcgagtgcaacgtttccacagtacccacaacatgaat
ccaggttcactgccaccctgcgctgatcggcgtggcctgcacgtacagagccaccccagc
gtagacagcaacctgacccgcaacgcctactctcccagaccccctagcatcaatgagaac
gtggtgatggaggccgtggctgctggggtagacggcccagggctagagtgcgacctgggg
ctggtggaggatgagctggtgctgccagatgatgtggtacagtacatcaaggctcacacc
ggtggtaccttggatgacggcattcggcaggggtatcccacagaaggtactggcttcccc
gagaactctaagctgcccagtcctgggctacaaggccaccgcaggctagcagctgccgac
tccaacatgggtccttctgctcctggactcgggggctgccagctgagctacagcccctcc
tccaacctcaacaagagcaacatgcctgtgcagtggaatgaggtgagttctggcaccgtg
gatgccctgcctacccaggtgaagccacctcctttccctcacagcaacctggctgtggtc
caacagaagccagcctttggccagtatccaggatataatccacaatccgtgcagagcagc
tccggaggtctagacagcacccagccgcacctacagcttcgaggagccccctctgcatca
agagggagctacacgcaacagcctcgacagccagctgcaggcagtcagtgcctgggtatg
agtgcggccatgagcccgcaggccagctacagccaagcccacccccagctgagcccaaac
attgtcagcggatctctgaaccagttttctccctcctgcagcaatatggcagccaagccc
agccacctgggactccctcagcaaatggaagttgtccccaatgccaccatcatgaatggc
catcaacgggagcacggggtccccaattcatccctggctgcggtgtcacaacctcaccca
gtcctgagctatccccagcaggacagctaccaacagggctccaaccttctgtcatcccat
cagcctggcttcatggagtcccagcagaacgcgggctttggtctcatgcagcctcggcca
cccctggaacccaacacggccagccgtcaccgtggagtacgttctgggcaacagcagttg
tatgccaggaccactggccaagccatggtcacatcagccaaccaagagacagcagaagct
atgcccaagggaccagcagggaccatggtatccctagctcctcagccatctcaggacaca
gggcgggcacaagatcagaacacgctatactactatggccagatccacatgtatgaacag
aatggaggctgcccagccgtgcagccccagccgccacaaccacaagcttgctcagacagt
atccagcctgagcctttgccttcaccgggagtcaaccaggtgtctagcaccgtggactcc
cagctcctggagcccccccagattgactttgatgccatcatggatgatggtgatcactcg
agtttgttttctggtgcactgagcccaacccttctccacaatctctcccagaattcctca
cgcctcaccacaccccggaattccttgacactgccctccatccctgcgggcatcagcaac
atggccgtgggcgacatgagttccatgctcaccagcctggctgaagagagcaagttttta
aacatgatgacctaa

DBGET integrated database retrieval system