KEGG   Mus musculus (mouse): 14634
Entry
14634             CDS       T01002                                 

Gene name
Gli3, AI854843, AU023367, Bph, GLI3-190, GLI3FL, Pdn, Xt, add
Definition
(RefSeq) GLI-Kruppel family member GLI3
  KO
K06230  zinc finger protein GLI3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    14634 (Gli3)
   04024 cAMP signaling pathway
    14634 (Gli3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14634 (Gli3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    14634 (Gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14634 (Gli3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    14634 (Gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 14634
NCBI-ProteinID: NP_032156
MGI: 95729
Ensembl: ENSMUSG00000021318
Vega: OTTMUSG00000024401
UniProt: Q61602 Q3TYX7 B2RUG4
Position
13 A1; 13 5.43 cM
AA seq 1583 aa
MEAQAHSSTATERKKAENSIGKCPTRTDVSEKAVASSTTSNEDESPGQIYHRERRNAITM
QPQSVQGLNKISEEPSTSSDERASLIKKEIHGSLPHLAEPSLPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVPSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADILPSAATAGAGAIHMEYLHAMDSTRFPSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQSKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGSRGQQEQPEGTTLVKEEADKDESKQEPEVIYET
NCHWEGCTREFDTQDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDSGSHS
QSRSPGRPTQGAFGEQKELSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSVADLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHIKL
ERLKQVNGMFPRLNPILPSKAPAVSPLIGNGTQSNNNYSSGGPGTLLPSRSDLSGVDFTV
LNTLNRRDSNTSTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQGDGLPSLLSLTPVQQYRLKAKYAAATGGPPPTPLPHMERLSLKTKMALL
GEGRDSGVTLPPVHPPRRCSDGGGHTYRGRHLMPHDALANSVRRASDPVRTVSENMSLAR
VQRFSSLNSFNPPNLPPSVEKRSLVLQNYTRQESSQPRYFQASPCPPSITENVALEALTM
DADANLNDEDLLPDDVVQYLNSQNQTGYGQQLQSGISEDSKVAHEPEDLDLAGLPDSHVG
QEYPALEQPCSEGSKTDLPIQWNEVSSGTSDLSSSKLKCGQQRPSAQQPRGFGLYNNMVV
HPHNLWKVGTGPAGGYQTLGENSSTYNGPEHFAIHSGDGLGTNGNTFHEQPFKTQQYGSQ
LNRQPLTSSALDHACGTGIQGSKLKGNSLQENGGLLDFSLSVAPNELAGNTVNGMQTQDQ
MGQGYIAHQLLSGSMQHQGPSRPGQQVLGQVGATSHINIYQGTESCLPGTQDNSSQPSSM
AAIRGYQPCASYGGNRRQAMPRGNLTLQQGQLSDMSQSSRVNSIKMEAQGQSQQLCSTVQ
NYSGQFYDQTMGFSQQDRKAGSFSLSDANCLLQGNGTENSELLSPGANQVTSTVDSFESH
DLEGVQIDFDAIIDDGDHTSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPSLSMGTTNM
AIGDMSSLLTSLAEESKFLAVMQ
NT seq 4752 nt   +upstreamnt  +downstreamnt
atggaggcccaggcccacagctctacggcgactgagaggaagaaagctgaaaattccatt
gggaaatgtcccacgagaacagatgtcagcgagaaggccgtggcctctagtaccacttcc
aatgaggatgaaagtcctggacagatctatcaccgagagagaagaaacgcaatcactatg
cagcctcagagtgtgcagggtctcaacaaaatcagtgaggagccctcgacgtctagtgat
gagagggcctcgctgatcaagaaagagatccatggctctctaccacatctggcggagccc
tctctcccttaccgtgggactgtgtttgccatggatccccggaatggctacatggagcct
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattatgatccatctcctattcctccattacatgtgccttct
gccttatctagtagcccgacgtatccagacttgcccttcattaggatctccccacaccgt
aatcccactgcagcctcagagtcccccttcagccccccacacccctacatcaacccatat
atggactacatccgctcattgcacagcagcccatccctctccatgatctctgctgcccga
gggctgagccctacagatgctccccatgctggagtcagccctgcggaatactatcaccag
atggctctgctgacaggccagcgcagcccttatgcagacatccttccctcagctgccact
gctggtgcaggggccatccatatggagtaccttcatgccatggacagcaccagatttccc
agccctaggctgtcagctaggcccagccgaaagcgcacactgtcaatatcgccactgtca
gatcatagcttcgaccttcagaccatgataagaacatcccctaactccttggttacaatc
ctcaataattcccgtagcagctcttcagcaagtggttcctatgggcacttatcggcaagt
gcaatcagccctgcattgagcttcacctacccctccgctcctgtgtctcttcacatgcat
caacagatcctaagccgacagcaaagcttaggctccgcattcggacacagccctcctctc
atccaccctgctccaacatttccaacacagagacctatccctgggattccgacagttctg
aaccccgtccaggtcagctctggcccttctgagtcctcacagagcaagcccacaagcgag
tctgcagtgagcagcactggtgaccctatgcataataagcggtccaagatcaagcctgat
gaagacctccccagcccagggtcacggggccagcaggaacagccggaaggaacaacccta
gtcaaggaggaagcggacaaagatgaaagcaagcaggagcctgaagtcatctacgagaca
aactgccactgggaaggctgcaccagagagttcgacacccaagatcagcttgtgcatcat
atcaataatgaccacattcatggagaaaagaaggagttcgtgtgccgctggcttgattgt
tcacgagagcagaaaccgttcaaagcccagtacatgttggtagtgcatatgagaagacac
actggggagaagcctcacaaatgtacatttgaaggttgcacaaaagcctactcaagactc
gaaaacctgaaaacccacttgagatctcacactggagagaagccatacgtctgtgagcat
gagggctgcaacaaggctttctctaatgcttcagatcgggccaagcaccaaaacagaaca
cattccaatgagaaaccgtatgtatgcaaaatccctggctgcaccaagcgttacacagac
cccagctctctccggaaacacgtgaagactgtgcatggccctgaggctcatgttaccaag
aagcagcgtggggacatgcaccctcggcctccacccccgagagattccggcagccattca
cagtccaggtcccctggccggccaactcagggagcatttggtgagcagaaggagctgagc
aacactacctcaaagcgggaagagtgcctccaggtgaagactgtcaaggctgagaagccc
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgactgatggaggtagtgtagcagac
ctcagtgccatcgatgaaaccccaatcatggactcgaccatttccacggcaaccacagcc
cttgctttgcaagccaggagaaacccggcagggaccaaatggatggagcacatcaaactt
gaaaggctaaaacaagtgaatggaatgtttccaagactgaaccctattctaccctccaaa
gcccctgcggtatctcctctcataggaaatggcacacagtccaataacaactatagctcg
ggtgggcccgggaccctcctcccgagcagaagtgacctgtcaggtgtagacttcacagtg
ctgaacacactcaacaggagagacagcaataccagcactatcagctctgcctacctgagc
agccgcagatcctcgggcatctccccctgcttttccagccgcaggtccagcgaggcgtcc
caggctgaagggcgaccccagaatgtgagtgtggctgactcctacgatcccatctccaca
gatgcttcaaggaggtccagcgaggccagccagggtgacgggctgcccagtctgctcagc
ctcacacccgtgcagcagtaccgccttaaggccaagtatgcagctgccacaggtggccca
ccacccacacctctgccccacatggagaggctgagcctgaagaccaagatggccttgcta
ggggaagggagggactctggggtgaccctgcctccagtccatcctcctcgaagatgcagt
gatgggggaggtcacacatacagagggcgtcacctgatgcctcatgatgcactagcgaac
agtgtgaggagagccagcgaccctgtgaggacagtctcggagaacatgtcacttgccagg
gttcaacgcttcagcagcctcaatagctttaatcctccaaatttgcctccatcggtggaa
aagcgtagcttagtgctgcaaaattatacccggcaggagagcagccaaccccggtacttc
caggcatccccttgccctcccagcatcacagagaatgttgccctggaggctctgaccatg
gatgctgatgctaacttgaatgatgaagacctcctgccagatgatgtggtacagtattta
aattcccagaaccaaacagggtatgggcagcagttgcagagtggcatctctgaagacagc
aaagtagcccatgagccagaggacttggacttagcagggctgccagacagtcatgttggc
caggagtacccagctctggagcagccctgctctgagggcagtaaaactgatttgcccatc
cagtggaacgaggtcagttctggaacttctgatctgtcatcctccaagctgaagtgtggt
cagcagcgccctagcgcacagcagcctcggggttttgggctatacaacaatatggtggta
cacccacataatctgtggaaggttggcactggcccagctgggggatatcagaccctcggg
gagaatagcagtacctacaatggcccagagcactttgcaatccacagtggggatggactt
ggcaccaatggaaatactttccatgaacagccctttaagacccagcagtatgggagccag
ctcaacaggcagccactgacttccagtgctctagatcatgcctgtggtacagggattcaa
gggtccaagctaaaaggcaacagcttgcaagagaatgggggtttgctagatttcagcctg
tccgtggcaccaaatgagttagctggcaacacagtgaatggcatgcaaacccaagatcaa
atgggacagggatacattgcccatcagctactcagtggcagcatgcaacaccaggggccc
agccgccctggtcaacaggtactagggcaggttggtgctacctcacatatcaacatctat
caagggacagagagctgcctaccagggactcaggacaacagcagccagccatcaagcatg
gcagctatcaggggctaccagccctgtgccagctatgggggtaacaggcgtcaggcaatg
ccaaggggcaacctcactctgcaacaaggacagctcagtgacatgagtcagagcagcagg
gtgaacagcatcaaaatggaggcacaaggtcagtcccagcagctctgctctaccgtgcag
aattattccggtcagttctatgaccaaaccatgggcttcagtcagcaagacaggaaagct
ggctcgttctccctctcagatgccaactgcctgctccaagggaatggcactgaaaactct
gagttactctccccaggtgctaaccaggtaacaagcacagttgacagctttgagagtcat
gacctagaaggtgtgcagattgattttgatgccatcatagatgatggggaccataccagc
ctaatgtcaggggccttgagcccaagtattattcagaacctttcccacagctcctcccgt
ctcaccactccgcgggcatccctcccattcccatccctatccatgggcaccaccaacatg
gctatcggggatatgagttctttgctgacctcccttgcagaagaaagcaagttccttgca
gttatgcagtag

DBGET integrated database retrieval system