KEGG   Mus musculus (mouse): 14696
Entry
14696             CDS       T01002                                 

Gene name
Gnb4, 6720453A21Rik, G(beta)4
Definition
(RefSeq) guanine nucleotide binding protein (G protein), beta 4
  KO
K04538  guanine nucleotide-binding protein subunit beta-4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04062  Chemokine signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04926  Relaxin signaling pathway
mmu05032  Morphine addiction
mmu05034  Alcoholism
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14696 (Gnb4)
   04371 Apelin signaling pathway
    14696 (Gnb4)
   04151 PI3K-Akt signaling pathway
    14696 (Gnb4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    14696 (Gnb4)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14696 (Gnb4)
  09156 Nervous system
   04724 Glutamatergic synapse
    14696 (Gnb4)
   04727 GABAergic synapse
    14696 (Gnb4)
   04725 Cholinergic synapse
    14696 (Gnb4)
   04728 Dopaminergic synapse
    14696 (Gnb4)
   04726 Serotonergic synapse
    14696 (Gnb4)
   04723 Retrograde endocannabinoid signaling
    14696 (Gnb4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14696 (Gnb4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14696 (Gnb4)
  09165 Substance dependence
   05032 Morphine addiction
    14696 (Gnb4)
   05034 Alcoholism
    14696 (Gnb4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    14696 (Gnb4)
   05163 Human cytomegalovirus infection
    14696 (Gnb4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14696 (Gnb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14696 (Gnb4)
   04031 GTP-binding proteins [BR:mmu04031]
    14696 (Gnb4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   14696 (Gnb4)
GTP-binding proteins [BR:mmu04031]
 Heterotrimeric G-proteins
  Beta Subunits
   Beta [OT]
    14696 (Gnb4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like eIF2A
Other DBs
NCBI-GeneID: 14696
NCBI-ProteinID: NP_001334991
MGI: 104581
Ensembl: ENSMUSG00000027669
Vega: OTTMUSG00000016427
UniProt: P29387
Position
3; 3 A3
AA seq 340 aa
MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYA
MHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDGQIITSSGDTTCALWDIETGQQTTTF
TGHSGDVMSLSLSPDLKTFVSGACDASSKLWDIRDGMCRQSFTGHISDINAVSFFPSGYA
FATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCSVWDAL
KGGRSGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgagcgagctggagcagctgaggcaggaggctgaacagcttcggaatcagatccaggat
gctcggaaggcctgcaatgatgccacgctggttcagatcacgtctaatatggactccgtg
ggccgaatacaaatgcgaacaaggcgcacgctgcgcggccacctcgctaagatctacgcc
atgcactggggatatgattccaggctactagtcagtgcttcgcaagatggaaaattaatt
atttgggatagctatacgacaaataagatgcacgccatccctctgaggtcctcctgggtg
atgacctgtgcctacgccccgtccgggaactacgttgcctgtggaggcttggataacatc
tgctccatatacaacctaaagacccgagaggggaatgtgcgggtgagccgagaattgcca
ggacacacgggctacttgtcctgctgccgattcttagatgatggacaaatcattacaagt
tcgggagacacgacttgtgctttgtgggacattgagaccggacagcagactacgaccttc
acgggacactcgggtgacgtgatgagcctctcactgagtcctgacttgaagacctttgtg
tctggtgcttgtgatgcatcctcaaagctgtgggatatccgagatgggatgtgtagacag
tctttcaccggacacatctcagacatcaacgctgtcagtttcttcccgagtggatatgcc
tttgccactggttctgatgatgccacatgccgactctttgacctccgtgcagaccaggag
ctcctgctatactctcatgacaatatcatctgtggcattacttctgtggccttctcaaag
agtgggcgcctcctgttagccggctatgacgacttcaactgcagtgtgtgggacgctctg
aaaggaggccggtcaggtgtccttgctggtcatgacaaccgtgttagctgcttaggtgtg
actgatgacggcatggctgtggccactggctcctgggacagttttcttagaatctggaat
tga

DBGET integrated database retrieval system