KEGG   Mus musculus (house mouse): 14711
Entry
14711             CDS       T01002                                 
Symbol
Gnmt
Name
(RefSeq) glycine N-methyltransferase
  KO
K00552  glycine N-methyltransferase [EC:2.1.1.20]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00270  Cysteine and methionine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    14711 (Gnmt)
   00270 Cysteine and methionine metabolism
    14711 (Gnmt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.20  glycine N-methyltransferase
     14711 (Gnmt)
SSDB
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_23 Ubie_methyltran TehB MTS TPMT Methyltransf_15 PCMT CMAS NNMT_PNMT_TEMT
Other DBs
NCBI-GeneID: 14711
NCBI-ProteinID: NP_034451
MGI: 1202304
Ensembl: ENSMUSG00000002769
Position
17:complement(47036590..47040091)
AA seq 293 aa
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHR
VLDVACGTGVDSIMLVEEGFSVMSVDASDKMLKYALKERWNRRKEPSFDNWVIEEANWLT
LDKDVLSGDGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDY
ILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPGTGRDGSPGFSKFR
LSYYPHCLASFTELVRAAFGGRCQHSVLGDFKPYKPGQAYVPCYFIHVLKKTD
NT seq 882 nt   +upstreamnt  +downstreamnt
atggtggacagcgtgtaccgtacccgctccctgggggtggcggccgaagggctcccggac
cagtatgcagatggggaggccgcacgtgtgtggcagctgtacatcggggacacccgcagc
cgtaccgcagagtacaaggcgtggttgcttgggctgttgcgccagcacgggtgccacagg
gtgctggacgtagcctgtggcacaggagtggactccatcatgctggtggaagagggcttc
agcgtgatgagcgtggacgccagcgacaagatgctgaaatatgcgcttaaggagcgctgg
aaccggaggaaagagccatcctttgacaattgggtcattgaagaagccaactggttgacg
ctggacaaagatgtgctttcaggagatggctttgatgctgtcatctgccttgggaacagt
tttgctcacttgccagactgcaaaggtgaccagagcgagcaccggctggcactaaagaac
attgcaagcatggtgcggcccgggggcctgctggtgatcgaccaccgcaactacgactat
atcctcagcacaggctgtgcgcccccggggaagaacatctactataagagtgacctgacc
aaggacattacgacgtcagtactgacagtcaacaacaaagcccacatggtaaccctggac
tacacagtgcaggtgccaggcactggcagagatggctctcctggcttcagtaagttccgg
ctctcttactacccacactgtttggcgtctttcacggagttggtgcgagcagcctttggg
ggcaggtgccagcacagcgtcctgggtgacttcaagccctacaagcctggccaggcctac
gttccctgctacttcatccatgtgctcaagaagacagactga

DBGET integrated database retrieval system