KEGG   Mus musculus (mouse): 15116Help
Entry
15116             CDS       T01002                                 

Gene name
Has1, HAS
Definition
(RefSeq) hyaluronan synthase 1
  KO
K00752  hyaluronan synthase [EC:2.4.1.212]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    15116 (Has1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.212  hyaluronan synthase
     15116 (Has1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   15116 (Has1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Chitin_synth_2 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 15116
NCBI-ProteinID: NP_032241
MGI: 106590
Ensembl: ENSMUSG00000003665
UniProt: Q61647 Q3UUP6
Position
17 A3.2; 17 10.53 cM
AA seq 583 aa AA seqDB search
MRQDMPKPSEAARCCSGLARRALTIIFALLILGLMTWAYAAGVPLASDRYGLLAFGLYGA
FLSAHLVAQSLFAYLEHRRVAAAARRSLAKGPLDAATARSVALTISAYQEDPAYLRQCLT
SARALLYPHTRLRVLMVVDGNRAEDLYMVDMFREVFADEDPATYVWDGNYHQPWEPAEAT
GAVGEGAYREVEAEDPGRLAVEALVRTRRCVCVAQRWGGKREVMYTAFKALGDSVDYVQV
CDSDTRLDPMALLELVRVLDEDPRVGAVGGDVRILNPLDSWVSFLSSLRYWVAFNVERAC
QSYFHCVSCISGPLGLYRNNLLQQFLEAWYNQKFLGTHCTFGDDRHLTNRMLSMGYATKY
TSRSRCYSETPSSFLRWLSQQTRWSKSYFREWLYNALWWHRHHAWMTYEAVVSGLFPFFV
AATVLRLFYAGRPWALLWVLLCVQGVALAKAAFAAWLRGCVRMVLLSLYAPLYMCGLLPA
KFLALVTMNQSGWGTSGRKKLAANYVPVLPLALWALLLLGGLARSVAQEARADWSGPSRA
AEAYHLAAGAGAYVAYWVVMLTIYWVGVRRLCRRRSGGYRVQV
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgagacaggacatgccaaagccctcagaggcagcgcgttgctgctctggcctggccagg
cgagcactcacgatcatctttgccctgctcatcctgggcctcatgacctgggcctacgcc
gcaggcgttcctctggcttcagatcgctatggactcctggcctttggcctctatggggca
ttcctcagcgcacacctagtggcacagagcctcttcgcttacctggagcaccgaagggtg
gcagcggctgcgcggcgctccttggcgaaggggcccctggatgcggccactgcacgcagc
gtggcactcaccatctcagcctaccaagaggatcccgcttacctgcgccagtgcttgacc
tccgcgcgcgccttgctgtacccgcacacgaggttacgcgtgctcatggtggtggacggc
aaccgcgctgaggatctgtacatggtggacatgttccgagaagtcttcgccgatgaggac
cccgccacttatgtgtgggatggcaactaccatcagccctgggaaccagcggaggctacg
ggcgctgtcggtgaaggtgcctaccgggaggtggaggcggaggaccccgggcggttggcg
gtggaggcgctggtgagaacacgcaggtgcgtgtgcgtggctcagcgttggggcggcaaa
cgtgaggtcatgtacacagctttcaaggcactgggcgactccgtggactacgtgcaggtc
tgtgactcagacacaagactagaccccatggcactgctggagcttgtgcgagtgttggat
gaagacccccgggtaggggctgttggaggggatgtgaggatccttaaccctctggactcc
tgggtcagcttcttgagcagtcttcgatactgggtagccttcaatgtggaacgagcttgt
cagagctacttccactgtgtgtcctgcatcagtggtcctctgggtctatacagaaacaat
ctcctgcagcagttcttggaggcctggtacaaccaaaagttcctgggcacccactgcaca
tttggggatgacaggcacctcaccaaccgaatgcttagcatgggctatgctaccaagtat
acctcgcgctccagatgctactcggagacgccctcctccttccttcgttggttgagccaa
cagacccgctggtccaaatcttacttccgagagtggctatacaatgctctgtggtggcat
cgccaccacgcatggatgacctatgaagcggtggtctcgggcctcttccctttcttcgtg
gctgccacggtgttgaggctcttctatgcagggcgcccgtgggctctgctctgggtgctg
ctctgtgtgcagggcgtagcactggcaaaggcagcctttgcagcctggctgcgtggctgc
gtgcgcatggtgctgctgtcactctatgcaccactctacatgtgcggcctcctgcctgcc
aaattcctagcgttggttaccatgaatcaaagtggttggggtacctcgggccggaagaaa
ctggctgctaactacgtccccgtgttgcccctggcactctgggctctactgctgcttgga
ggcctggcccgcagtgtggcccaggaggccagagctgactggagtggcccatcccgagca
gctgaagcctaccaccttgctgctggggctggtgcctatgtggcctactgggtggtaatg
ttaactatctactgggtaggtgtgaggaggctgtgcagacgtcggagcggtggttaccgt
gtccaagtatga

DBGET integrated database retrieval system