KEGG   Mus musculus (mouse): 15162Help
Entry
15162             CDS       T01002                                 

Gene name
Hck, AI849071, Bmk
Definition
(RefSeq) hemopoietic cell kinase
  KO
K08893  hemopoietic cell kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    15162 (Hck)
   04062 Chemokine signaling pathway
    15162 (Hck)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    15162 (Hck)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    15162 (Hck)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    15162 (Hck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     15162 (Hck)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   15162 (Hck)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    15162 (Hck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 15162
NCBI-ProteinID: NP_034537
MGI: 96052
Ensembl: ENSMUSG00000003283
Vega: OTTMUSG00000015777
UniProt: P08103 A0A087WQ04
Position
2 H1; 2 75.41 cM
AA seq 524 aa AA seqDB search
MGGRSSCEDPGCPRSEGRAPRMGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKL
GPNNSNSMPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLAT
KKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSL
SVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVLHYKKGKDGLCQKLSVPCV
SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKSLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFS
AQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC
PEELYNIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ctggggggtcggtctagctgcgaggatccgggctgcccacgaagcgaagggcgggcgccc
aggatgggatgcgtgaagtccaggttcctccgagatggaagcaaggcctcaaaaacagag
ccaagtgccaatcagaagggccctgtgtatgtgccggatcccacgtcctccagcaagctg
ggaccaaacaacagcaacagcatgcccccagggtttgtggagggctctgaggataccatt
gtggtcgcactgtacgactatgaggctattcaccgtgaagacctcagcttccagaaggga
gaccagatggtggttctggaggaggctggggagtggtggaaggcacggtccctggctacc
aagaaggaaggctacatcccaagcaactatgtggctcgagttaactctttggagacagaa
gagtggttcttcaaggggatcagccggaaggatgcagagcgccacctcctggctccaggc
aacatgctgggctccttcatgatccgggacagtgagaccaccaaagggagctactcgttg
tctgttcgagactttgacccccagcacggagacaccgtgaagcactataagatccggacg
ctggacagtggaggcttctacatctctccaaggagcaccttcagcagcctgcaggaactc
gtgctccactacaagaaggggaaggatgggctctgccagaagctgtcagtgccctgtgtg
tctcccaaaccccagaagccatgggagaaagatgcttgggagattcctcgagaatccctc
cagatggagaagaaacttggagctgggcagtttggagaagtgtggatggccacctacaac
aagcacaccaaagtggcggtgaagacaatgaagccagggagcatgtccgtggaggccttc
ctggctgaggccaacctgatgaagtcgctgcagcatgacaaactggtgaagctacacgct
gtggtctctcaggagcccatctttattgtcacggagttcatggccaaaggaagcctgctg
gactttctcaagagtgaagaaggcagcaagcagccactgccaaaactcattgacttctca
gcccagatctcagaaggcatggccttcattgagcagaggaactacatccaccgagacctg
agggctgccaacatcttagtctctgcatcactggtgtgtaagattgctgactttggactg
gcacgaatcatcgaggacaatgagtacacagctcgggaaggagccaagttccccatcaag
tggacagctcctgaagccatcaactttggttccttcaccatcaagtcagatgtctggtcc
tttggtatcctgctgatggaaattgtcacctatggccggatcccttacccaggtatgtca
aacccagaggtgattcgggcactagagcatgggtaccgtatgcctcgaccagataactgt
ccagaagagctctacaatatcatgatccgctgctggaagaaccgccccgaggaacggccc
acctttgaatacatccagagtgtgctggatgacttctacacggccactgagagccagtat
cagcagcagccttga

DBGET integrated database retrieval system