KEGG   Mus musculus (mouse): 15377
Entry
15377             CDS       T01002                                 

Gene name
Foxa3, Hnf-3, Hnf-3g, Hnf3, Hnf3g, Tcf-3g, Tcf3g
Definition
(RefSeq) forkhead box A3
  KO
K08038  forkhead box protein A3, hepatocyte nuclear factor 3-gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    15377 (Foxa3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    15377 (Foxa3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix tissue-specific regulators
    15377 (Foxa3)
SSDB
Motif
Pfam: Forkhead Forkhead_N HNF_C Ribosomal_60s
Other DBs
NCBI-GeneID: 15377
NCBI-ProteinID: NP_032286
MGI: 1347477
Ensembl: ENSMUSG00000040891
Vega: OTTMUSG00000020440
UniProt: P35584
Position
7 A3; 7 9.46 cM
AA seq 353 aa
MLGSVKMEAHDLAEWSYYPEAGEVYSPVNPVPTMAPLNSYMTLNPLSSPYPPGGLQASPL
PTGPLAPPAPTAPLGPTFPSLGTGGSTGGSASGYVAPGPGLVHGKEMAKGYRRPLAHAKP
PYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKV
ARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSASRNGTAGSAT
SATTTAATAVTSPAQPQPTPSEPEAQSGDDVGGLDCASPPSSTPYFSGLELPGELKLDAP
YNFNHPFSINNLMSEQTSTPSKLDVGFGGYGAESGEPGVYYQSLYSRSLLNAS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctgggctcagtgaagatggaggctcatgacctggccgagtggagctactacccggag
gcgggcgaggtgtattctccagtgaatcctgtgcccaccatggcccctctcaactcctac
atgaccttgaacccactcagctctccctaccctcccggagggcttcaggcctccccactg
cctacaggacccctggcacccccagcccccactgcgcccttggggcccaccttcccaagc
ttgggcactggtggcagcaccggaggcagtgcttccgggtatgtagccccagggcccggg
cttgtacatggaaaagagatggcaaaggggtaccggcggccactggcccacgccaaacca
ccatattcctacatctctctcataaccatggctattcagcaggctccaggcaagatgctg
accctgagtgaaatctaccaatggatcatggacctcttcccgtactaccgggagaaccag
caacgttggcagaactccatccggcattcgctgtccttcaatgactgcttcgtcaaggtg
gcacgctccccagacaagccaggcaaaggctcctactgggccttgcatcccagctctggg
aacatgtttgagaacggctgctatctccgccggcagaagcgcttcaagctggaggagaag
gcaaagaaaggaaacagcgccacatcggccagcaggaatggtactgcggggtcagccacc
tctgccaccactacagctgccactgcagtcacctccccggctcagccccagcctacgcca
tctgagcccgaggcccagagtggggatgatgtggggggtctggactgcgcctcacctcct
tcgtccacaccttatttcagcggcctggagctcccgggggaactaaagttggatgcgccc
tataacttcaaccaccctttctctatcaacaacctgatgtcagaacagacatcgacacct
tccaaactggatgtggggtttgggggctacggggctgagagtggggagcctggagtctac
taccagagcctctattcccgctctctgcttaatgcatcctag

DBGET integrated database retrieval system