KEGG   Mus musculus (mouse): 16337Help
Entry
16337             CDS       T01002                                 

Gene name
Insr, 4932439J01Rik, CD220, D630014A15Rik, IR, IR-A, IR-B
Definition
(RefSeq) insulin receptor
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04520  Adherens junction
mmu04910  Insulin signaling pathway
mmu04913  Ovarian steroidogenesis
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04960  Aldosterone-regulated sodium reabsorption
Module
mmu_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    16337 (Insr)
   04015 Rap1 signaling pathway
    16337 (Insr)
   04010 MAPK signaling pathway
    16337 (Insr)
   04066 HIF-1 signaling pathway
    16337 (Insr)
   04068 FoxO signaling pathway
    16337 (Insr)
   04072 Phospholipase D signaling pathway
    16337 (Insr)
   04022 cGMP - PKG signaling pathway
    16337 (Insr)
   04151 PI3K-Akt signaling pathway
    16337 (Insr)
   04152 AMPK signaling pathway
    16337 (Insr)
   04150 mTOR signaling pathway
    16337 (Insr)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    16337 (Insr)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    16337 (Insr)
   04923 Regulation of lipolysis in adipocyte
    16337 (Insr)
   04913 Ovarian Steroidogenesis
    16337 (Insr)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16337 (Insr)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    16337 (Insr)
   04213 Longevity regulating pathway - multiple species
    16337 (Insr)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    16337 (Insr)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16337 (Insr)
   04931 Insulin resistance
    16337 (Insr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16337 (Insr)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:mmu04090]
    16337 (Insr)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16337 (Insr)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   16337 (Insr)
CD molecules [BR:mmu04090]
 Proteins
  16337 (Insr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476
Motif
Other DBs
NCBI-GeneID: 16337
NCBI-ProteinID: NP_034698
MGI: 96575
Ensembl: ENSMUSG00000005534
Vega: OTTMUSG00000031438
UniProt: P15208 Q3TPM5
Position
8 A1.1; 8 1.82 cM
AA seq 1372 aa AA seqDB search
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPT
SQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKA
DDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG
CRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSV
VIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLRELG
QGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLL
GVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYL
NAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKD
GVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMR
MCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLD
RSSHCQREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgggagaggatgtgagacgacggctgtgccattgctggtggccgtggccgcg
ttgctggtgggcacagccggccacctgtaccctggagaggtgtgccctggtatggacatc
cggaacaacctgaccaggctacatgagctggagaactgctcagtcattgagggccatctg
cagatcctcctgatgttcaagaccagacccgaagatttccgagacctcagtttccccaaa
ctcatcatgatcacagattacctgcttctcttccgtgtctatggtctggaaagtctgaaa
gacctcttcccaaatctcacagtcatccgaggctcccgtctcttcttcaactatgccctg
gttatcttcgagatggtccacctgaaggagctggggctttataacctcatgaacatcacc
cggggctctgtccgcatcgagaagaataatgagctctgctacctggccactatcgactgg
tcccgtatcctggattctgtggaggacaactacattgtactgaacaaagatgacaacgag
gaatgtggggatgtctgtccaggcaccgccaagggcaagaccaactgtcctgccactgtc
atcaatgggcagtttgtggaacggtgctggacacacagtcattgtcagaaagtttgccca
accatctgtaagtcacatggctgcacagctgaaggcctgtgctgccacaaagagtgcctg
ggcaactgttcggaacctgatgaccccaccaagtgtgtggcctgtcgcaacttctatctg
gatggtcagtgtgtggagacctgcccgccaccctactatcacttccaggactggcgctgt
gtgaacttcagcttctgccaagaccttcacttcaaatgcaggaactctcggaagcctggc
tgccaccaatacgtcattcacaacaataagtgcatccccgagtgcccgtctggctatacc
atgaattccagcaacttgatgtgcaccccatgtctgggaccctgccctaaggtctgccaa
atcctcgaaggtgagaagaccattgattctgtgacatctgcccaggagctccgaggctgc
actgtgatcaacggtagcctgatcatcaacatccgagggggcaacaacctggcagctgag
ctggaggctaaccttggcctcattgaagaaatttcgggatttctaaagatccgccgctcc
tatgctctggtatcactttctttcttcaggaagctacatctgattcgaggagagaccttg
gaaattgggaactattctttttatgccttggacaaccagaacctgaggcaactctgggac
tggagcaaacacaacctcaccatcactcagggcaagctcttcttccattacaacccgaaa
ctctgcttgtctgaaattcacaagatggaagaagtctccggaactaagggccgtcaggag
aggaacgacattgccctgaagaccaatggggaccaggcatcgtgtgaaaatgaattgctt
aaattttctttcattcggacatcttttgacaagatcctgttgaggtgggaaccctactgg
ccccccgacttccgagatctcctgggattcatgttgttctacaaagaggccccttatcag
aatgtgacagagtttgatgggcaggatgcttgtggctccaacagctggactgtggtggat
attgacccgccccagaggtccaacgaccccaagtctcagaccccaagccaccctgggtgg
ctgatgcggggcctcaaaccctggacccaatacgccatctttgtgaagaccttggttacc
ttctctgatgaacggcggacctatggagccaaaagtgatatcatctatgtgcaaacagat
gccactaatccttctgtccccctggatcccatatcagtttctaattcctcatctcagatt
atcttaaagtggaagcccccctctgaccccaatggcaacatcacacactacctggtgtac
tgggagaggcaagcagaggacagcgagctgtttgagctggattattgtctcaaagggctg
aagctcccttcacggacctggtccccaccctttgagtctgatgattctcagaagcacaat
cagagtgagtatgacgactcggccagtgagtgctgctcatgccctaagactgactctcag
atcctgaaggagctggaggagtcttcattcaggaagaccttcgaggattacctgcacaac
gtggtttttgtccccaggccatcccgaaagcgaagatcccttgaagaggtggggaatgtg
acagccaccacactcacacttccagatttccccaacgtctcctctaccattgtgcccaca
agtcaggaggagcacaggccatttgagaaagtggtgaacaaggagtcacttgtcatctct
ggcctgagacacttcactgggtaccgcattgagctgcaggcatgcaatcaagattcccca
gatgagaggtgcagtgtggctgcctacgtcagtgcccggaccatgcctgaagctaaggca
gatgacatcgttggccctgtgactcatgaaatctttgagaacaatgttgtacacttaatg
tggcaagagccaaaggaacctaatggtctgattgtgctatatgaagtgagctatcgccga
tatggtgatgaggagctgcacctctgtgtctcccggaagcattttgccctggagcggggc
tgcaggctgcgagggctctccccaggaaactacagtgttcgagtccgggctacctctctg
gcaggaaatggctcctggacagaacccacctatttttatgtgactgattatttagatgtc
ccatcaaatattgccaaaattatcattggacccctcatctttgtcttcctcttcagtgtt
gtgattggaagtatttatctatttctgagaaagaggcagccggatgggccaatgggacca
ctgtatgcatcttcaaaccctgagtacctcagtgccagtgatgtgtttccatcttctgtg
tacgtgccggacgagtgggaggtgcctcgagagaagatcacccttcttcgagagctgggg
cagggatcctttggtatggtgtatgaaggcaatgccaaggatatcatcaagggtgaggca
gagacccgtgttgcggttaagactgtcaatgagtcagccagtcttcgagaacggatcgag
ttcctcaatgaggcatcagtcatgaagggattcacctgccatcatgtggtccgccttctt
ggggtggtatccaaaggacagccaacgctggtagtgatggaattgatggctcatggagac
ctgaaaagtcacctccgttctctgaggccagatgctgagaataacccaggccgccctccc
cctaccttgcaagaaatgattcagatgacagcagaaattgctgatggcatggcatacttg
aacgccaagaagtttgtgcaccgggacctggcagctcgaaactgcatggttgcccatgat
tttactgtcaaaattggagactttggaatgacaagggacatctacgagacagattactat
cggaaagggggcaagggactgcttcctgtgaggtggatgtcacctgagtccctgaaggat
ggagtctttactgcttcttctgatatgtggtcctttggggtggtcctttgggaaatcact
agcctggctgagcaaccttatcaaggcctgtctaatgaacaggtgttgaagtttgtcatg
gatggaggctatctggatccccctgataactgtccagagagactcactgacctgatgcgc
atgtgctggcagttcaaccccaagatgaggccaaccttcctggaaatcgtcaacctgctc
aaggatgacctccaccccagctttccagaagtttccttcttctacagcgaggagaacaag
gctcctgagagtgaggagctggagatggagtttgaagacatggagaatgtcccgttggat
cgttcctctcactgtcagagagaagaggctgggggccgggagggagggtcctcactgagc
atcaaacggacctatgatgaacacatcccctatacccacatgaatgggggcaagaagaac
ggacgtgtccttaccctgccaaggtcaaacccttcctaa

DBGET integrated database retrieval system