KEGG   Mus musculus (mouse): 16600
Entry
16600             CDS       T01002                                 

Gene name
Klf4, EZF, Gkl, Gklf, Zi, Zie
Definition
(RefSeq) Kruppel-like factor 4 (gut)
  KO
K17846  krueppel-like factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16600 (Klf4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    16600 (Klf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16600 (Klf4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    16600 (Klf4)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4
Other DBs
NCBI-GeneID: 16600
NCBI-ProteinID: NP_034767
MGI: 1342287
Ensembl: ENSMUSG00000003032
Vega: OTTMUSG00000007231
UniProt: Q60793 F2YID5
Structure
PDB: 

Position
4 B3; 4 29.76 cM
AA seq 483 aa
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSHMKRLPPLPGR
PYDLAATVATDLESGGAGAACSSNNPALLARRETEEFNDLLDLDFILSNSLTHQESVAAT
VTTSASASSSSSPASSGPASAPSTCSFSYPIRAGGDPGVAASNTGGGLLYSRESAPPPTA
PFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLTTPGSEYS
SPSVISVSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSN
GHRPNTHDFPLGRQLPTRTTPTLSPEELLNSRDCHPGLPLPPGFHPHPGPNYPPFLPDQM
QSQVPSLHYQELMPPGSCLPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAH
LRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMK
RHF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaggcagccacctggcgagtctgacatggctgtcagcgacgctctgctcccgtccttc
tccacgttcgcgtccggcccggcgggaagggagaagacactgcgtccagcaggtgccccg
actaaccgttggcgtgaggaactctctcacatgaagcgacttcccccacttcccggccgc
ccctacgacctggcggcgacggtggccacagacctggagagtggcggagctggtgcagct
tgcagcagtaacaacccggccctcctagcccggagggagaccgaggagttcaacgacctc
ctggacctagactttatcctttccaactcgctaacccaccaggaatcggtggccgccacc
gtgaccacctcggcgtcagcttcatcctcgtcttccccggcgagcagcggccctgccagc
gcgccctccacctgcagcttcagctatccgatccgggccgggggtgacccgggcgtggct
gccagcaacacaggtggagggctcctctacagccgagaatctgcgccacctcccacggcc
cccttcaacctggcggacatcaatgacgtgagcccctcgggcggcttcgtggctgagctc
ctgcggccggagttggacccagtatacattccgccacagcagcctcagccgccaggtggc
gggctgatgggcaagtttgtgctgaaggcgtctctgaccacccctggcagcgagtacagc
agcccttcggtcatcagtgttagcaaaggaagcccagacggcagccaccccgtggtagtg
gcgccctacagcggtggcccgccgcgcatgtgccccaagattaagcaagaggcggtcccg
tcctgcacggtcagccggtccctagaggcccatttgagcgctggaccccagctcagcaac
ggccaccggcccaacacacacgacttccccctggggcggcagctccccaccaggactacc
cctacactgagtcccgaggaactgctgaacagcagggactgtcaccctggcctgcctctt
cccccaggattccatccccatccggggcccaactaccctcctttcctgccagaccagatg
cagtcacaagtcccctctctccattatcaagagctcatgccaccgggttcctgcctgcca
gaggagcccaagccaaagaggggaagaaggtcgtggccccggaaaagaacagccacccac
acttgtgactatgcaggctgtggcaaaacctataccaagagttctcatctcaaggcacac
ctgcgaactcacacaggcgagaaaccttaccactgtgactgggacggctgtgggtggaaa
ttcgcccgctccgatgaactgaccaggcactaccgcaaacacacagggcaccggcccttt
cagtgccagaagtgtgacagggccttttccaggtcggaccaccttgccttacacatgaag
aggcacttttaa

DBGET integrated database retrieval system