KEGG   Mus musculus (mouse): 17076
Entry
17076             CDS       T01002                                 

Symbol
Ly75, CD205, DEC-205, DEC205
Name
(RefSeq) lymphocyte antigen 75
  KO
K06559  lymphocyte antigen 75
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    17076 (Ly75)
   04090 CD molecules [BR:mmu04090]
    17076 (Ly75)
   04091 Lectins [BR:mmu04091]
    17076 (Ly75)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   17076 (Ly75)
CD molecules [BR:mmu04090]
 Proteins
  17076 (Ly75)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 6: Mannose receptor family
   17076 (Ly75)
SSDB
Motif
Pfam: Lectin_C fn2 UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 17076
NCBI-ProteinID: NP_038853
MGI: 106662
Ensembl: ENSMUSG00000026980
Vega: OTTMUSG00000012816
UniProt: Q60767
Position
2:complement(60122447..60213617)
AA seq 1723 aa
MRTGRVTPGLAAGLLLLLLRSFGLVEPSESSGNDPFTIVHENTGKCIQPLSDWVVAQDCS
GTNNMLWKWVSQHRLFHLESQKCLGLDITKATDNLRMFSCDSTVMLWWKCEHHSLYTAAQ
YRLALKDGYAVANTNTSDVWKKGGSEENLCAQPYHEIYTRDGNSYGRPCEFPFLIGETWY
HDCIHDEDHSGPWCATTLSYEYDQKWGICLLPESGCEGNWEKNEQIGSCYQFNNQEILSW
KEAYVSCQNQGADLLSIHSAAELAYITGKEDIARLVWLGLNQLYSARGWEWSDFRPLKFL
NWDPGTPVAPVIGGSSCARMDTESGLWQSVSCESQQPYVCKKPLNNTLELPDVWTYTDTH
CHVGWLPNNGFCYLLANESSSWDAAHLKCKAFGADLISMHSLADVEVVVTKLHNGDVKKE
IWTGLKNTNSPALFQWSDGTEVTLTYWNENEPSVPFNKTPNCVSYLGKLGQWKVQSCEKK
LRYVCKKKGEITKDAESDKLCPPDEGWKRHGETCYKIYEKEAPFGTNCNLTITSRFEQEF
LNYMMKNYDKSLRKYFWTGLRDPDSRGEYSWAVAQGVKQAVTFSNWNFLEPASPGGCVAM
STGKTLGKWEVKNCRSFRALSICKKVSEPQEPEEAAPKPDDPCPEGWHTFPSSLSCYKVF
HIERIVRKRNWEEAERFCQALGAHLPSFSRREEIKDFVHLLKDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSAVMMEPEFQQDFDIRDCAAIKVLDVPWRRVWHLYEDKDYAYWKPF
ACDAKLEWVCQIPKGSTPQMPDWYNPERTGIHGPPVIIEGSEYWFVADPHLNYEEAVLYC
ASNHSFLATITSFTGLKAIKNKLANISGEEQKWWVKTSENPIDRYFLGSRRRLWHHFPMT
FGDECLHMSAKTWLVDLSKRADCNAKLPFICERYNVSSLEKYSPDPAAKVQCTEKWIPFQ
NKCFLKVNSGPVTFSQASGICHSYGGTLPSVLSRGEQDFIISLLPEMEASLWIGLRWTAY
ERINRWTDNRELTYSNFHPLLVGRRLSIPTNFFDDESHFHCALILNLKKSPLTGTWNFTS
CSERHSLSLCQKYSETEDGQPWENTSKTVKYLNNLYKIISKPLTWHGALKECMKEKMRLV
SITDPYQQAFLAVQATLRNSSFWIGLSSQDDELNFGWSDGKRLQFSNWAGSNEQLDDCVI
LDTDGFWKTADCDDNQPGAICYYPGNETEEEVRALDTAKCPSPVQSTPWIPFQNSCYNFM
ITNNRHKTVTPEEVQSTCEKLHSKAHSLSIRNEEENTFVVEQLLYFNYIASWVMLGITYE
NNSLMWFDKTALSYTHWRTGRPTVKNGKFLAGLSTDGFWDIQSFNVIEETLHFYQHSISA
CKIEMVDYEDKHNGTLPQFIPYKDGVYSVIQKKVTWYEALNACSQSGGELASVHNPNGKL
FLEDIVNRDGFPLWVGLSSHDGSESSFEWSDGRAFDYVPWQSLQSPGDCVVLYPKGIWRR
EKCLSVKDGAICYKPTKDKKLIFHVKSSKCPVAKRDGPQWVQYGGHCYASDQVLHSFSEA
KQVCQELDHSATVVTIADENENKFVSRLMRENYNITMRVWLGLSQHSLDQSWSWLDGLDV
TFVKWENKTKDGDGKCSILIASNETWRKVHCSRGYARAVCKIPLSPDYTGIAILFAVLCL
LGLISLAIWFLLQRSHIRWTGFSSVRYEHGTNEDEVMLPSFHD
NT seq 5172 nt   +upstreamnt  +downstreamnt
atgcggacgggccgggtgaccccgggcctggcggcggggctactcctgctgttgctgcgg
tccttcgggcttgtggagccttctgagagctcaggtaatgatccattcaccatcgtccat
gaaaacactggcaagtgcatccagccgctgtctgactgggtagtggcccaggactgtagc
ggaactaacaacatgttgtggaagtgggtgtcccagcaccgcctctttcacctggaatcc
cagaagtgcctcggcctcgatattaccaaagccacggacaacctgcgaatgttcagctgt
gactccaccgtcatgctgtggtggaaatgtgagcaccattcgctgtacaccgctgcccag
tacaggctagctctgaaagatggatatgccgtagccaatacgaatacatctgatgtctgg
aagaagggaggctccgaggaaaacctttgtgcccagccttatcatgagatatacaccaga
gatgggaattcctacgggagaccttgtgaattccctttcttgattggtgagacatggtac
catgactgcattcatgatgaagatcatagtgggccatggtgtgccactaccctaagttat
gaatatgatcaaaagtggggcatctgcctactaccagaaagtggctgtgaaggtaactgg
gaaaagaatgagcagattggaagttgctaccaatttaataatcaggaaattctgtcttgg
aaagaagcttatgtttcctgtcagaaccaaggagctgacttactgagcatccacagtgct
gccgaattagcctacattacgggaaaagaggacattgctagacttgtttggcttggactg
aatcagctctattctgcgagaggttgggaatggtcagacttcaggccactcaaatttctt
aactgggatccaggcacgcccgttgcacctgtgattggtgggtcaagctgtgccagaatg
gacacagagtccgggctgtggcaaagtgtttcctgtgaatctcagcagccttacgtctgc
aagaagccactgaacaacacgctggagctcccagatgtttggacttacacagatacccac
tgccatgtgggctggctgccaaataatgggttttgctatctgctggcgaatgaaagtagt
tcctgggatgcagcacatttgaaatgcaaagccttcggtgcagacctcatcagcatgcac
tccttagcagatgtggaggtggttgtcacgaaactccataatggggatgtcaaaaaagaa
atatggacaggccttaaaaacacaaacagccctgctttgttccagtggtcggacggaacg
gaagttactctaacgtactggaatgagaatgagccgagtgttcccttcaacaagactccc
aactgtgtttcctatttaggaaagttaggtcagtggaaagtccagtcctgtgagaagaaa
ctcagatatgtatgcaagaaaaagggagaaataactaaggatgcagagtcggataagctg
tgtccgccagacgagggctggaagagacatggagaaacctgttacaagatttatgagaaa
gaggcccctttcggaacgaactgcaacctgaccatcactagcaggttcgagcaggaattc
ttgaattatatgatgaagaactatgataagtcccttcggaagtacttctggactggcctg
agagaccctgactctcgaggagaatacagttgggccgttgctcagggagtaaagcaggct
gtgaccttttccaactggaattttcttgaaccggcgtctccaggcgggtgcgtggctatg
tctactggaaagactcttggcaagtgggaagtgaagaactgcagaagcttccgtgctctt
tcaatatgcaagaaagtgagcgaaccccaggagcctgaagaagcagcccccaagcccgac
gacccctgtcctgaaggctggcacactttcccctccagcctttcttgttataaggtgttc
catatagaaagaatcgtaagaaagaggaactgggaagaagccgaaaggttctgccaagcc
cttggagctcacctacccagcttcagtcgtagagaggaaattaaggactttgtgcatttg
ttaaaggaccagttcagtgggcagcgttggttgtggattggtctgaataagagaagccct
gatttacaagggtcctggcagtggagtgaccggacaccagtgtctgctgtgatgatggag
ccggagtttcaacaggattttgacatcagagactgtgctgccatcaaggtccttgatgta
ccttggcgaagagtctggcatctctatgaggacaaggactatgcttactggaaacctttt
gcttgtgatgccaagcttgagtgggtgtgccagattccaaaaggtagcactccccagatg
ccagactggtataatccagagcgcactggaattcatgggcccccagttataattgaagga
agtgaatactggtttgttgctgatccccacttaaactacgaagaagccgtcttatactgt
gctagcaatcacagctttcttgccacgataacatcgttcacaggactaaaagctatcaaa
aacaaactagcaaatatttctggcgaggaacagaagtggtgggtgaaaacgagtgagaat
ccaattgatcgttactttctaggctcgcgccgccgcctgtggcaccatttccccatgacg
tttggagatgaatgtttgcacatgtcagccaagacgtggcttgttgacttaagtaaacga
gcggactgtaatgccaagttgcccttcatctgtgaaagatacaatgtctcttcattagag
aaatacagcccagatcctgcagccaaagtacagtgcactgagaagtggattccttttcaa
aataagtgcttcctaaaggtcaactctgggcccgttacgttttctcaagcaagcggcatt
tgtcattcctacggcggcacccttccttccgtgctgagccggggtgaacaagatttcatt
atatccttgcttcctgaaatggaagctagtctatggattggtctgcgctggactgcctac
gaaaggataaacagatggacagacaacagagagctgacctacagcaactttcacccactg
ctggtcggtcggaggctgagcataccaacgaatttctttgatgatgagtcccacttccac
tgcgccttgattcttaatctcaaaaagtcaccgcttactgggacctggaattttacttcc
tgttcagaacgacactctctgtctctctgtcaaaaatactcagagactgaagacggacag
ccctgggagaacacttcaaaaacagtgaagtatctaaataacctatacaaaatcatctcg
aagcccctgacgtggcacggcgctctgaaggagtgcatgaaagagaagatgaggttggtg
agcatcacagacccttaccagcaggccttcctcgcagtgcaggccaccctgcgcaacagc
tccttctggatcggactctccagtcaagatgatgaactcaactttggttggtcagatggg
aaacgtcttcaatttagtaactgggctggaagcaatgagcaacttgatgactgcgtgata
ttagacacagatggattctggaaaacagctgactgtgatgataaccagcctggcgccatt
tgctactatccaggaaatgagactgaggaggaggtcagagcactggacactgctaaatgc
ccgtctcctgtacagagcaccccatggataccattccagaactcctgctacaatttcatg
attaccaacaacaggcataagacagtcacaccggaggaagtgcagtccacgtgcgagaag
ctgcattcgaaagcacacagtctgagcattcggaatgaggaggagaatacctttgttgtg
gaacagcttctgtacttcaattatattgcctcatgggtcatgttaggaataacctatgaa
aacaattctttgatgtggtttgataaaactgcattgtcctacacacactggagaacggga
agaccaactgtgaaaaatggcaaatttttggctggtctaagtactgatggattctgggat
attcagtctttcaatgttattgaagaaacacttcatttttaccagcacagtatttctgct
tgtaaaattgaaatggttgactatgaggacaaacacaatggcaccctgccacagttcatt
ccatataaggacggcgtctacagcgttattcagaagaaggtgacgtggtatgaagcattg
aacgcgtgctctcaaagtgggggagagttggccagtgttcacaacccaaatgggaagctc
tttctggaagacattgtgaaccgtgacggattccctctctgggttgggctctcaagtcat
gatggaagcgaatcgagtttcgaatggtccgatggcagagcatttgactatgtcccatgg
cagagcctacaatctcccggagactgtgtcgtcttatatccaaaaggaatttggagacgt
gaaaaatgcctgtctgttaaggatggtgctatttgttacaagcctacaaaagataaaaag
ctgatctttcatgtaaaatcatcaaaatgtccagtggcaaagagggatggtccccagtgg
gtccagtatgggggccactgttacgcttcggaccaggtactgcacagcttctcagaggcc
aaacaagtgtgtcaagagcttgatcattcggcaactgttgtcaccatagcagatgaaaat
gagaataagtttgtgagcagactgatgagggagaactataatattactatgagagtttgg
cttggcctgtctcagcattcactcgatcagtcttggagttggctcgatggattagatgtg
acatttgtcaaatgggaaaataaaactaaggatggtgatgggaaatgtagcattttaata
gcttcaaatgaaacctggagaaaagtccattgctcacgtggctatgcaagagctgtctgc
aaaattcctctgagcccggactacacaggcatagccatcctgtttgccgtgctgtgcctc
ttagggctcatcagcttggcgatttggttcctcttgcaacgatcccatatccgctggacc
ggcttctcctcggttcggtatgaacatggaaccaacgaagacgaggtgatgctcccttct
ttccacgactaa

DBGET integrated database retrieval system