KEGG   Mus musculus (house mouse): 171395
Entry
171395            CDS       T01002                                 
Symbol
Pkd1l1, AA444596
Name
(RefSeq) polycystic kidney disease 1 like 1
  KO
K04987  polycystin 1L1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    171395 (Pkd1l1)
   04040 Ion channels [BR:mmu04040]
    171395 (Pkd1l1)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   171395 (Pkd1l1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   171395 (Pkd1l1)
SSDB
Motif
Pfam: REJ Polycystin_dom PKD PLAT PKD_4 Ion_trans ig
Other DBs
NCBI-GeneID: 171395
NCBI-ProteinID: XP_036013024
MGI: 2156538
Ensembl: ENSMUSG00000046634
Position
11:complement(8782025..8924365)
AA seq 2551 aa
MLLLSFSNPPPGISHTCNLSASWYHPESSSPLTQHPPRATLVTQPENVEHFAICCFPETD
AQALPALGIRVHVASGTALCLLLDFGDNCGAQMRLCTLAGATTVTGYHQYRKEGVYELKA
VVHDFHRAEELGPYYVDISHGNVSVFMNSSSIHDSEALSFADSLPQQRGTVVVHCFSSIS
SYNVSFISQTQVASGQAWCGVTVGYKMQSVSVYTNGTVFAANTNITFVAITEETIPLEFA
WYFGENPPVMTTSRSIRRRLSVPQWYRVKVKATSRIGSVVSEPHLIRVQKRIMANRLVST
ASALVNANVSFECRLNFGTDVAYLWNFGDDTIELGSSSSSHVYSREGEFTVEVLAFNNVS
STTLRKQLFIVREPCQPPPVKNMGPAKVQIWRSQPLRLGVTFEAAILCNISQGLSYTWSF
VSAEMTTVTLPTAVNTRRQTIMLPSYTLECGNYTAIAKVQIKGSMVYSNYCVGVEVRARA
PVSVISEGTHIFISTATSTFIILRGAQSYDPDNPGAALRYHWTCTAASSPRWPCFDNSTS
YQVDTQAPAISFPAKWLSECCDQFLVTLTVSSRGQNSSQALMFLSTRPDLAFRFVHISWV
NFRDISVNWNEEVSLRAVCEDCGDVPDLTYSWDLFLVNATEKSAVEVPFCSTVGLLGALA
LGTSLKSSKSDLPSNLRAPLTPHSPEPSPTPLGWTALSNLGSISAESTAGGHHVPASGAV
AGSGEPMEEYSSLSSLAEEALMTNSSEGSWPSPSSSTDFDDFEAYYSDIQEAVLSLGRQP
GTSTNFQEAGPSLSAEESASYGDNLLGPFLHTGRAKPTLMIDWPKALVSQAAFHGYTTSG
IMGPAVTIKPFSLSSGKTYVLQASVASKHVLLGKAQLYLTVNQAPQDMSCQVRPHHGMEA
YTIFSVFCMSGKPDFHYEFRYRIGNTSSHTLYRGQDTQHYFLLPAGDSSDNYKVIVSTEI
TDGHGSKVQPCTVAVTVLPRYHGNDCCDKELYNSTLESLSTLRLAGSYMETRNYITMITG
ILSRLYVESRNTSSCGQWSQIQDVLISSACKVPYTDQEGMMDSIHILRDLISFPNKLSLT
SAMCIFKYTKMFLAQGQFSRRLLVDKKLRVEFVLLISGVWEAAKEDARDGDYLQEEGMKI
ISDMLLACLSDEHQIHVSTGQMEFQTLLHRSPQSSIQNLGFVQVHFPSDLASLHSTTQEA
TQSSCYISQLMFFMKSPYLGGQVPGQVGGVMIPRLYSCESRRPILRGQLETPVTMEFGEE
DYLVKHKRNPAMFVLLRDEVNVHRFTGLSENSQESLQIHIKFSKPVTRPFPIILLVRFSE
KATPSDFLVKRVYFWDEQTVQMYVPAAPWKGANVGYLSLLDADYDRKPPNKYLAGAVNYT
VHFQWIQCVFWDKTEWRSEGPYPQPGSSPEKVNCSYHHLAPVSVLRRKLNATLEVSSISE
FQSHPHNLLPGIFSAFLLVLYGILVSKSRYVDCHEKKNPGFIFLEEDTLPGYQLYAVVID
TGFRSPVRFTSKVFIVLCGENGCSETKELCCPEKPLFGRNSRHTFILSIPNQLGPLQKIR
LWHDSSGSSPCWFISHVMVKELCSGQAWFFSAQCWLAVSKLGGHVLREFFCLSHGLGFWK
LFYSKFTEYLEDFHIWLSLYSQPPSRSYLHTQRLAVSFCLLCVYSCLTALVTVRDHQQRP
LDVGPTAITLEPFCMALLCTLLACPVAQLLSLLFRCSKEARGDMQASTQWPLRGVKTETP
QGHDSSGRPDSRQPSPHPTSDLLPWNDQAWRIAASSSAVVCSPFPMEACSHKHHDLREKS
HYSPPSSQAPGSGFEELGSQKSRVCLLWSSSVAWAISGSASLACGLGTGFLGYWFVPAQC
MWWLYLLLLSLVCCAFITQPLMICLAALVFAWKRKHDSKFFTESLQDATKGLDLELEEHS
RTRVPLSPISYSPDTAEEAERVLATRQRERHLRWAQTPSKAKLRVTGERLRRESIMQAAL
RDMTTHSIMLLLLLFIAYGRFCPGEISLNHAIRKAFTRKANHSLGDLSSTEDWWDWTLST
LLDELYPERTSARAWGAQPGALGGQCHLIGPPVVKLLKISAGTACTPPRPFSELVEDVLP
MHSNDLDLENQNVSPGGPETCGVKKESYMHSLGKTRHEAHAALTALRASKWIDHSTRAMS
VHFTLYNPPTQLFTSVILGTECLPSGGLVPSFLVESFRIFYSDSALKYLLMLSELLFLVL
NVIHLCFQLWGMTTKGILSYWRKPRHWLELSMVGVAIAYYAASGHLTTLAVNITDQFHKG
LYQRLVDIGLMVSWHQRARCLQGILLFLWMLKYVHLLSSLSTMTPFSAVTCFPLFRVLLV
GALLLAAHYHSRWFLLFTGTLSHGTSAEAFPGLLLQFPGRSKKDSWHNCLKSDHGVMRCY
YGTLFLLLATLGFRMLRATFLTVFQNRKSSHRKPLVTLKDIAVYTWHKVLTLLGLETTLE
ETEVATDHIYYLDEFSSLLDELLMKIDGLSDSLELSILENQWKRALESRAGDSPPVGSSE
YQATGVPLEARREHYTRIPWNPTYRHLSTVR
NT seq 7656 nt   +upstreamnt  +downstreamnt
atgctgcttctgagcttctccaaccctcctcctggcatttctcacacctgcaacctctct
gcatcctggtatcatcctgagagttccagtcctctcactcagcatcctcccagggccacc
ttggtgacacagcctgaaaatgttgagcactttgccatctgctgcttcccagaaacagat
gctcaggcacttccagctctgggaatccgtgttcacgtggcttccggaacagctctttgt
ctgctgctggactttggggacaattgtggagctcagatgagactgtgtacattggcaggt
gcaactactgtgactggctaccatcagtacaggaaagaaggagtctatgagctcaaggct
gttgtccatgactttcatagagccgaggaactggggccctattatgtggacattagccat
gggaatgtgtctgtcttcatgaattccagctctatccatgatagcgaagctctttccttt
gctgactccctcccacagcagagaggcacagtcgtggtgcattgtttttcatccatttct
tcatacaatgtgtcctttatttctcagacccaagtggccagcggccaggcctggtgtggt
gtgactgttgggtataagatgcaatccgtgtctgtctataccaatggaactgtgtttgct
gctaacacaaacatcacatttgtggctattaccgaggaaactatacccctggagttcgct
tggtatttcggagagaacccaccagtgatgacaacttccagaagcattagaagaaggctg
agcgtccctcagtggtaccgtgtgaaggtcaaggccaccagcaggatcggcagtgtggtc
tctgaaccccacctcatcagggtgcagaagagaatcatggccaatcgacttgtgtccact
gcctcagccctggtaaatgccaatgtgtcctttgagtgcaggctcaactttggcactgat
gtagcctacctttggaactttggagatgacaccattgagttgggcagcagctcctccagc
catgtctacagcagggagggagagtttacagttgaagtccttgccttcaataatgtcagc
tccactaccctaagaaagcagcttttcatcgtgcgggagccttgccaaccacccccagtg
aagaacatggggcctgcgaaggtgcagatatggaggtctcagcccctgagactaggagtg
acatttgaagctgccatcctctgtaacatttcccaagggctttcctacacctggagcttt
gtgagtgctgagatgaccactgttaccctccctactgctgtcaacacccgcagacagacc
atcatgctcccaagctacacactggaatgtgggaactacaccgccatcgccaaggttcag
atcaagggaagcatggtgtatagcaactactgtgttggtgtagaagttcgagctagggcg
cctgtcagcgtcatctctgaaggcacacacatcttcatctccacggccacctcaaccttc
atcatcctcagaggggcccagtcctatgaccctgacaacccaggggctgctctcaggtat
cactggacttgcacagcggccagctcaccaaggtggccctgctttgataactctacttca
taccaagtggacacgcaagctcctgccatttccttcccagcaaaatggctcagtgaatgc
tgtgaccagttccttgtgacactgacggtctctagcaggggacagaactcatcacaggcc
ttgatgttcctgtctacccgtcctgacttggccttcagattcgtccacatctcatgggtc
aactttagagacatctctgtgaactggaatgaagaagtgtctctccgggctgtgtgtgaa
gactgtggagatgtcccagacctcacgtattcctgggacctcttcctagtcaatgcaaca
gagaagagtgcagtggaagtccccttctgtagtactgtggggctgctaggtgccttggca
cttgggaccagtctgaagtcctctaagtctgatctgccatcaaatctgagagcaccactg
acaccacactcaccggagccttcacccacgcctctgggctggacagctctttccaacctg
ggaagcatttctgctgagtccacagctggtggccaccacgttcctgcttcaggagctgtg
gcaggctcaggggagcctatggaggagtatagctcactgagttccctggctgaggaagcc
ctgatgacgaacagctctgagggaagctggccctcccccagctcttccactgactttgat
gattttgaagcctattatagcgacatccaagaagcagtgctatccctaggaagacaacca
gggaccagtacaaacttccaggaagcaggaccaagcctgagtgctgaggagagtgccagt
tatggggacaacctgctgggccctttcctccacacaggtagagcaaagccaactctcatg
atcgactggcccaaggccctggtcagccaagctgccttccatggctacaccacatcaggt
atcatgggaccagctgtgacaataaaaccattctcactgagcagtggcaagacatatgtc
ttacaagcttctgtagcttcaaagcatgtcttactgggcaaggctcagctctacttaacg
gtcaaccaagctccgcaggacatgtcttgtcaggtgcgaccccaccatggtatggaggca
tataccatcttcagtgtcttctgcatgtcagggaaaccggactttcattatgaatttcgt
taccggataggaaacacttcctcacataccctgtaccgtggtcaagacacccagcattat
tttttattgccagctggtgattcttcggacaattacaaagtcattgtttcaactgagatc
acagatggccacggctccaaggtgcagccatgcactgtggcggtgactgtgctaccccgt
taccatggaaatgactgctgtgacaaggaactatataactccactctggaaagcctgtct
actctccggctggcaggaagttacatggaaaccaggaactacattaccatgatcactggg
atcctgagccgcttgtatgtggagagcagaaacacttcttcgtgtggtcagtggtcacaa
atacaggatgtattaatttcttcagcatgcaaagtaccttatacagatcaggaaggaatg
atggattctattcatatattgagagacctcataagcttccctaataagttgagcttgacg
agtgccatgtgcatcttcaaatacaccaagatgttccttgctcaaggccagttctccagg
aggttgctagtcgacaaaaaactaagagttgaatttgtccttctcatctctggagtctgg
gaagctgccaaagaggatgcgagggatggggactatctgcaggaagaaggcatgaagatc
atctctgacatgttactagcctgtctctcagacgagcatcagattcacgtaagcactggg
cagatggagttccagacccttctccatcgtagccctcagagctctatccagaacctaggc
ttcgtccaggtacatttccccagtgacctggcctccttgcacagtactactcaagaggca
acacaaagctcatgctatatcagccagctcatgttcttcatgaagagtccttatctaggg
ggacaagttcctgggcaggtgggtggtgtcatgatccctaggctctatagctgcgagagt
agaagacctatcctcagaggacaactggagacacctgtgactatggagtttggggaagaa
gactacctggtaaagcacaagagaaatccagccatgtttgtgttgcttcgggatgaggtg
aatgtccaccggtttactgggctttcagaaaactcccaggaatctttacagatacacatc
aaattctctaagcccgttacaagaccctttcccatcatactgttagtaaggttctctgag
aaagccacgccttctgattttcttgtgaagcgggtctacttctgggatgagcagactgta
caaatgtatgtacctgctgctccatggaaaggagccaatgtgggatatttatcgctatta
gatgctgactatgacaggaaacctccaaacaaatatcttgctggggctgtaaactataca
gtgcatttccagtggatccaatgtgtgttctgggacaagacagagtggcgatctgaaggt
ccctatccacagccaggatcgtctcctgaaaaagtcaactgcagctaccatcaccttgca
cctgtctctgtcctaagaagaaagctgaatgccactcttgaagtgagcagcatttctgag
tttcagagtcacccacacaacttgctccccggtattttcagtgcatttctcttggttctt
tatggaattttggtgagtaaaagcagatatgtagactgtcatgagaaaaagaatccaggt
tttatttttctggaagaagatacactgcctggctaccagctgtatgcagtcgtcatcgac
actggcttccggtcaccagtcagatttacctcaaaggttttcattgttctatgtggtgaa
aatggatgctcagaaacgaaagaactctgttgtccagagaagcccttatttggaaggaat
tccaggcacaccttcattctgagcatacctaaccaactgggtccactccagaagatccgc
ctctggcacgacagtagtggatcttccccatgctggttcatcagccacgtgatggtgaag
gagctatgctcaggacaagcctggttcttctctgctcagtgctggctggctgtgagcaaa
ttgggtggccatgtattacgagaattcttctgcctgagccatggtctcggtttctggaag
cttttctattcaaagttcactgagtacctggaggatttccacatctggctctcactgtac
agtcagcccccatccagaagctacctacacacacagcggcttgccgtgtccttctgcctg
ctgtgtgtctactcgtgcctcactgccctggtcactgtgcgagaccatcaacagcgcccc
ctggatgtggggcccacagctatcactctggaacccttctgtatggctctactgtgcacc
ctcctggcctgtccagttgcacagcttctgtcactgctcttcaggtgcagcaaggaagcc
agaggggatatgcaggcttcaacacagtggcctctaagaggagtgaagacagagacacct
cagggccatgattccagtgggagaccagattcaaggcagccctcaccacatcccacatca
gaccttctcccctggaatgaccaagcttggaggatagcagccagcagcagtgctgtggtc
tgttcaccgttcccaatggaggcctgcagccataagcatcatgatctgagagagaagagc
cattactctcctcccagttcacaagctcctggcagtggttttgaagaacttgggtcccag
aagtcaagggtctgtctgctctggtcaagctctgtggcctgggctatctctggatcagct
tccctggcctgtggtttggggacaggattcctaggctactggtttgtgccagcacagtgt
atgtggtggctatacctgctgcttctctctctggtctgctgcgcattcatcacccagcca
ctcatgatctgcttggcagcacttgtctttgcttggaaacggaaacatgacagcaagttt
tttactgagtctttacaagatgcgaccaagggtctggatttggaattggaagaacattcc
agaacccgtgttcctctttctcctatctcctatagtcctgacactgctgaggaggctgaa
agggtcttggctacccgacaacgagaacgccacctgcgctgggctcagacaccatccaag
gctaagctcagagtgaccggggagagactgaggagagagagcatcatgcaggcagccctg
agagacatgaccacacacagcatcatgctactgctgcttttgtttatagcatatgggaga
ttctgcccaggtgaaatttctctcaatcatgccatcaggaaagcatttacaagaaaggcc
aatcactccttgggggacctcagcagcacagaagactggtgggactggacgctgagcaca
ctgctagatgagctgtacccagaaagaacatctgctagagcctggggggctcagcctgga
gctcttggagggcaatgccacctaataggccccccggtggtcaaactgctgaagatttct
gctggcactgcatgcacgcctcccagaccattctcagagcttgtggaagatgtacttcct
atgcacagcaatgaccttgaccttgagaaccaaaatgtgtcccctggcggccctgagacc
tgtggcgtgaagaaagagagctacatgcatagcctaggaaaaacaagacatgaagcccat
gcagctctgactgccctcagggctagcaagtggatcgaccacagcacaagggccatgtct
gtgcacttcactctctacaaccctccaacacaactcttcacaagcgtgatcctgggcaca
gaatgtctcccctcaggaggtcttgtcccctcattcctggtagagtccttccgcatcttc
tacagtgactcagccctaaagtaccttcttatgctttctgagctgctgttcctggtactc
aacgtgatccacctctgtttccagctctgggggatgacaaccaagggcatcctcagctac
tggagaaaaccaagacactggctggagctctctatggttggagtagcaatagcctactat
gcagcctctggtcacctcactactcttgctgtgaacatcaccgaccagttccacaaagga
ctttatcagaggcttgtggacatcggcctgatggtgtcatggcatcagagggcgcgatgc
ctccaaggaatcctcttgttcctctggatgttgaaatatgttcatcttctcagctctcta
agcaccatgacacccttctcagcagtgacctgttttcctctcttcagagtcttgctggtg
ggggccctattgctggctgcccattaccactcgcgctggtttctgctcttcaccgggaca
ctgtcacatggcacctcggcagaagcatttcctgggctactgcttcaatttcctggaaga
agtaaaaaagactcatggcataactgtttgaagtctgaccacggagttatgcgttgttac
tatgggaccctctttctgttgctggctactctgggtttcagaatgttgagagctaccttc
ctgactgttttccaaaacagaaagtcttctcacagaaaacctctcgtgacacttaaagac
attgctgtttacacatggcataaagtcctcacccttctggggctggaaacaactttggaa
gagactgaagtggctacagaccatatttattacctggatgaattttcaagtctcttggat
gaacttctgatgaagatcgatggtttgtctgacagcctagaactttctatcctagaaaac
caatggaagagagcactagagtcaagggcaggtgacagtcctccagttggcagttcagag
taccaagctactggggtacctttggaggccagaagagagcactatactcggatcccctgg
aaccctacttataggcacttgtcaacagtcagatga

DBGET integrated database retrieval system