KEGG   Mus musculus (house mouse): 17188
Entry
17188             CDS       T01002                                 
Symbol
Maz, MAZI, PUR1, Pur-1, SAF-1, SAF-2
Name
(RefSeq) MYC-associated zinc finger protein (purine-binding transcription factor)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2_4 zf-C2H2 zf-C2H2_6 zf-C2H2_jaz zf-WRNIP1_ubi zf-Di19 zf-met DZR Zn-ribbon_8 FYVE GAGA Rad50_zn_hook UBZ_FAAP20 OSTMP1
Other DBs
NCBI-GeneID: 17188
NCBI-ProteinID: NP_001359450
MGI: 1338823
Ensembl: ENSMUSG00000030678
Position
7:complement(126621302..126626654)
AA seq 454 aa
MDPSNWSSFIFQGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPPPTPQAPAAEPLQV
DLLPVLAAAQESAAAAAAAAAAAAAVVTAPPAPAAASTVDTAALKQPPAPPPPPPAVSAP
AAEAAPPAAAATIAAAAATAVVAPTSTVAVAPVASVLEKKTKSKGPYICALCAKEFKNGY
NLRRHEAIHTGAKAGRVPSGAMKMPTMVPLSLLSVPQLSGASGGGGEAGAGGGTAAVAAG
GVVTTTASGKRIRKNHACEMCGKAFRDVYHLNRHKLSHSDEKPYQCPVCQQRFKRKDRMS
YHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRA
HTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQGPHHVCELCNKGTGEVCPMAAAAAAAAA
AAAAVVAAPPTAVGSLSGAEGVPVSSQPLPSQPW
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggatcccagcaactggagcagcttcatcttccagggtcacgcccagaaccccctgcag
gtcggggctgagctccagtcccgcttctttgcctcccagggctgcgcccagagtccattc
caggccgcgccggcgcccccacccacgccccaggccccggcggccgagcccctccaagtg
gacttgctcccggttctcgccgccgcgcaggaatcagccgcggcggcggcggctgctgcg
gcggctgccgctgcagtggttactgcacccccggcccctgccgccgcctccacagtggac
acagcggccctgaagcagcctccggcgcctcctccgccaccccctgccgtctccgcacca
gccgccgaggccgcgccccccgccgcggccgccactatcgcagcagcggctgccaccgct
gtcgtcgccccaacctcgacggtcgccgtggccccagttgcatctgtcttggagaagaag
acaaagagcaaggggccctacatttgcgccctgtgcgccaaggagttcaagaacggctac
aacctccgaaggcacgaagccatccacacgggagccaaggctggccgggtcccttcgggt
gctatgaagatgcccaccatggtgcccctgagcctcttgagtgtcccccagctgagcggg
gccagcgggggtgggggagaagccggggctggcggcggcacagccgcggtggcggccggt
ggcgttgtgaccacgactgcctctgggaagcgcatccggaagaatcacgcctgcgagatg
tgcggcaaggccttccgcgacgtctaccacctgaaccgacataagctgtcgcattcggac
gagaagccctaccagtgccctgtgtgccagcagcgcttcaagcgcaaggaccgcatgagt
taccacgtgcgctcacatgacggcgctgtgcacaagccctacaactgctcccactgtggc
aagagcttctcccggccggatcacctcaacagtcacgtcagacaagtgcactcaacagag
cggcccttcaaatgtgagaaatgtgaggcagcttttgctacgaaggatcgcctccgagcg
cacacagtccgacacgaggagaaggtgccatgtcatgtctgtggcaagatgctgagctcg
gcttatatttccgaccacatgaaggtgcacagccagggccctcaccatgtctgtgagctc
tgcaacaaaggtactggtgaggtttgtccaatggcggcagcggcagcagcagcggcggcg
gcggcagcagcagtggtggcagccccccccacagctgtgggctccctctctggggcagag
ggggtaccagtgagctctcagccacttccctcccagccttggtga

DBGET integrated database retrieval system