KEGG   Mus musculus (mouse): 17294
Entry
17294             CDS       T01002                                 

Symbol
Mest, AA408879, AI256745, Peg, Peg1
Name
(RefSeq) mesoderm specific transcript
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 DUF1057 Hydrolase_4 REV
Other DBs
NCBI-GeneID: 17294
NCBI-ProteinID: NP_032616
MGI: 96968
Ensembl: ENSMUSG00000051855
Vega: OTTMUSG00000014405
UniProt: Q07646
Position
6 A3.3; 6 12.53 cM
AA seq 335 aa
MVRRDRLRRMREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKTSGKFFTYKGLRIFYQ
DSVGVVGSPEIVVLLHGFPTSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHQYSI
FEQASIVESLLRHLGLQNRRINLLSHDYGDIVAQELLYRYKQNRSGRLTIKSLCLSNGGI
FPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTPVFGPYTRPTESELWDMWAVIR
NNDGNLVIDSLLQYINQRKKFRRRWVGALASVSIPIHFIYGPLDPINPYPEFLELYRKTL
PRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggtgcgccgagatcgcttgcgcaggatgagagagtggtgggtccaagtagggctcctg
gctgtgcccttgctggctgcgtacctgcacatcccgccccctcagctctcccctgctctg
cactcatggaagacttctggcaagtttttcacctacaaaggcctacgcatcttctaccaa
gattctgtcggtgtggtcggaagccctgagatagttgtgcttttacatggctttccaaca
tccagctatgactggtacaagatctgggaagggctgaccctgaggttccatcgagtgatc
gcccttgatttcttaggctttggcttcagtgacaagccgagaccacatcagtactccata
tttgagcaggccagcatcgtagagtcccttctgcggcacctggggctccagaaccgcaga
atcaacctgctgtctcacgattatggagatatcgttgctcaggaactgctgtacaggtac
aagcagaatcgatctggccggctcaccataaagagtctctgtctgtcgaatggaggtatc
tttcctgagacgcatcgtcctctccttctccaaaagctcctcaaagacggaggtgtgctt
tcccccatcctcaccaggctcatgaatttcttcgtgttctctcgaggtctcactccagtc
tttggaccgtatactcgacccactgagagtgagctgtgggacatgtgggctgtgattcgc
aacaatgacggcaacctggtcatcgacagtcttttacagtacattaatcaaaggaagaaa
ttcagaagacgctgggtgggagcgcttgcttctgtgtccatccccattcattttatctat
gggccattggatcctataaatccgtatccagagtttttggagctgtacaggaaaacgctg
ccgcggtccacagtgtcgattctggatgaccacattagccactacccacagctagaggat
cccatgggcttcttgaatgcatatatgggcttcatcaactccttctga

DBGET integrated database retrieval system