KEGG   Mus musculus (mouse): 18125
Entry
18125             CDS       T01002                                 

Gene name
Nos1, 2310005C01Rik, N-NOS, NC-NOS, NO, NOS, NOS-I, Nos-1, bNOS, nNOS
Definition
(RefSeq) nitric oxide synthase 1, neuronal
  KO
K13240  nitric-oxide synthase, brain [EC:1.14.13.39]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04145  Phagosome
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04730  Long-term depression
mmu04926  Relaxin signaling pathway
mmu04970  Salivary secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    18125 (Nos1)
   00330 Arginine and proline metabolism
    18125 (Nos1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    18125 (Nos1)
   04020 Calcium signaling pathway
    18125 (Nos1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    18125 (Nos1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    18125 (Nos1)
  09154 Digestive system
   04970 Salivary secretion
    18125 (Nos1)
  09156 Nervous system
   04730 Long-term depression
    18125 (Nos1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18125 (Nos1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18125 (Nos1)
   05014 Amyotrophic lateral sclerosis
    18125 (Nos1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     18125 (Nos1)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 PDZ PDZ_6 PDZ_2 Flavodoxin_5
Other DBs
NCBI-GeneID: 18125
NCBI-ProteinID: NP_032738
MGI: 97360
Ensembl: ENSMUSG00000029361
Vega: OTTMUSG00000016286
UniProt: Q9Z0J4
Position
5 F; 5 57.29 cM
AA seq 1429 aa
MEEHTFGVQQIQPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQA
GDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTI
RVTQPLGTPTKAVDLSRQPSASKDQPLAVDRVPGPSNGPQHAQGRGQGAGSVSQANGVAI
DPTMKNTKANLQDSGEQDELLKEIEPVLSILTGGGKAVNRGGPAKAEMKDTGIQVDRDLD
GKLHKAPPLGGENDRVFNDLWGKGNVPVVLNNPYSENEQSPASGKQSPTKNGSPSRCPRF
LKVKNWETDVVLTDTLHLKSTLETGCTEQICMGSIMLPSHHIRKSEDVRTKDQLFPLAKE
FLDQYYSSIKRFGSKAHMDRLEEVNKEIESTSTYQLKDTELIYGAKHAWRNASRCVGRIQ
WSKLQVFDARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGKHDFRVWNSQLI
RYAGYKQPDGSTLGDPANVEFTEICIQQGWKPPRGRFDVLPLLLQANGNDPELFQIPPEL
VLEVPIRHPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYMGTEIGVRDYCD
NSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIVDHHSATESFIK
HMENEYRCRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPDPWNTHVWKGTN
GTPTKRRAIGFKKLAEAVKFSAKLMGQAMAKRVKATILYATETGKSQAYAKTLCEIFKHA
FDAKAMSMEEYDIVHLEHEALVLVVTSTFGNGDPPENGEKFGCALMEMRHPNSVQEERKS
YKVRFNSVSSYSDSRKSSGDGPDLRDNFESTGPLANVRFSVFGLGSRAYPHFCAFGHAVD
TLLEELGGERILKMREGDELCGQEEAFRTWAKKVFKAACDVFCVGDDVNIEKANNSLISN
DRSWKRNKFRLTYVAEAPELTQGLSNVHKKRVSAARLLSRQNLQSPKSSRSTIFVRLHTN
GNQELQYQPGDHLGVFPGNHEDLVNALIERLEDAPPANHVVKVEMLEERNTALGVISNWK
DESRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATNEKEKQRLLVLSKGLQEYEEWKW
GKNPTMVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDEVHLTVAIVSYHTR
DGEGPVHHGVCSSWLNRIQADDVVPCFVRGAPSFHLPRNPQVPCILVGPGTGIAPFRSFW
QQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYSREPDRPK
KYVQDVLQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSEEDAGVF
ISRLRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS
NT seq 4290 nt   +upstreamnt  +downstreamnt
atggaagagcacacgtttggggtccagcagatccaacccaacgtcatttctgtccgtctc
ttcaaacgcaaagtgggaggtctgggcttcctggtgaaggaacgggtcagcaagcccccg
gtgatcatctcagatctgatccgaggaggtgccgcggagcagagcggccttatccaagcc
ggcgacatcattctcgccgtcaatgatcggcccctggtagacctcagctatgacagcgct
ctggaagttctcaggggcattgcctctgagacccatgtggtcctcattctgagaggccct
gagggctttactacacacctggagaccaccttcacaggggatggaacccccaagaccatc
cgtgtgacccagcccctggggacacccaccaaagctgtcgatctgtctcgccagccatca
gccagcaaagaccagccattagcagtagacagggtcccaggtcccagtaacggacctcag
catgcccaaggccgtggacagggagccggctcagtctcccaggctaatggtgtggccatt
gaccccacaatgaaaaataccaaggccaacctccaggacagcggagaacaggatgaactg
ctcaaagagatagaacctgtgttgagcatcctcaccggtgggggaaaagcagtcaacaga
gggggaccagccaaagcagagatgaaagacacaggaatccaggtggacagagacctcgac
ggcaaactgcacaaagctccgcccctgggcggggagaatgatcgagtcttcaatgatctg
tgggggaagggcaacgtccctgtggtcctcaacaacccgtattcagagaacgaacagtct
cccgcctcgggcaaacagtctcctaccaagaatggcagtccttccaggtgccctcgcttc
cttaaggtcaagaactgggagacagatgtggtcctcactgacaccctgcacctgaagagc
acgctggaaacggggtgcacagagcagatctgcatgggctccatcatgctgccatcccat
cacatacggaagtcagaagatgtccgcaccaaggaccagctcttccctctagccaaagaa
tttctcgaccaatactactcctccattaagaggtttggctccaaggcccacatggacagg
ctggaggaggtgaacaaggagatcgagagcaccagcacctaccagctcaaggacacggag
ctcatctatggcgccaagcatgcctggcggaacgcctctcgctgtgtgggcaggatccag
tggtccaagctgcaggtgttcgatgcccgagactgcaccacagcccatgggatgttcaac
tacatctgtaaccacgtcaagtacgccaccaacaaagggaacctcaggtcggccatcact
atattccctcaaaggactgatggcaagcatgacttccgagtgtggaactcgcagctcatc
cgctatgccggctacaagcagccagatggctctaccttgggcgatccagctaatgtggag
ttcacagagatctgtatacagcagggctggaaacccccaagaggccggttcgatgtgctg
cctctcctgctccaggccaatggcaatgaccctgaactctttcagatccccccagagctg
gtgctggaagtacccatcaggcaccccaagttcgactggtttaaggacctggggctcaaa
tggtatggcctccccgctgtgtccaacatgctgctggagattgggggcctggagttcagc
gcctgtccctttagtggctggtacatgggcacggagattggcgttcgtgattactgtgac
aactctcgatacaacatcctggaggaagtagccaagaaaatggatttggacatgaggaag
acatcctccctctggaaggaccaagccctggtggagattaacattgctgtcctatacagc
ttccagagtgacaaggtgaccattgtggaccaccactctgccaccgagtccttcatcaaa
cacatggagaatgagtaccgctgcagagggggctgtcccgccgactgggtgtggattgtg
ccccccatgtcgggcagcatcacccctgtcttccaccaggagatgctcaactaccggctc
accccgtcctttgagtaccagcctgatccatggaacacccacgtgtggaagggcaccaat
gggacccccacgaagcggcgagccattggcttcaagaaattggcagaggccgtcaagttc
tcagccaagctgatgggacaggccatggccaagagagtcaaagcgaccattctctacgcc
accgagacaggcaaatcccaagcctatgccaagaccctgtgcgagatcttcaagcatgcc
ttcgatgccaaggctatgtccatggaggaatatgacatcgtgcacctggagcacgaagcc
ctggtcttggtggtcaccagcacctttggcaatggagaccccccagagaatggggagaaa
ttcggctgtgctttgatggagatgaggcaccccaactctgtgcaagaggagaggaagagc
tacaaggtccgattcaacagcgtctcctcctattctgactcccgcaagtcatcaggcgat
ggaccagacctcagagacaactttgaaagtactggaccgctggccaatgtgaggttctca
gtcttcggcctgggctctcgggcataccctcacttctgtgcctttgggcacgcagtggac
actctcctggaggagctgggcggggagaggattctgaagatgagggagggagatgagctc
tgcggacaggaagaggctttcaggacctgggctaagaaagtcttcaaggcagcctgtgat
gtgttctgtgtgggggatgacgtcaacattgagaaggcgaacaattccctcattagcaat
gaccgcagctggaagaggaataaattccgcctcacttatgtggcagaagctccagagctg
acccaaggtctttccaatgttcacaaaaagcgagtctcagccgcccgactcctcagccgc
caaaacctgcaaagtcctaaatccagccgatcgaccatcttcgtgcgtctccacaccaac
gggaatcaggagttgcagtaccagccaggggaccacctgggtgtcttccctggcaaccat
gaggacctcgtgaatgcactcattgaacggctggaggacgcgccgcctgccaaccacgtg
gtgaaggtggaaatgctggaggaaaggaacacggctctgggtgtcatcagtaattggaag
gatgaatctcgcctcccaccctgcaccatcttccaggccttcaagtactacctggacatc
accacgccgcccacgcccctgcagctgcagcagttcgcctccctggccaccaatgagaaa
gagaagcagcggctgctggtcctcagcaaggggcttcaggaatatgaggaatggaaatgg
ggcaagaaccccacaatggtggaggtgctggaggagttcccgtccatccagatgccggcc
acacttctcctcacacagctgtcgctgctacaacctcgctactattccatcagctcctct
ccagacatgtaccccgacgaggtgcacctcaccgtggccatcgtgtcctaccatacccga
gatggagaaggaccggttcaccacggggtgtgctcctcctggctcaaccgaatacaggct
gacgatgtcgtcccctgcttcgtgagaggtgcccctagcttccacctgcctcgaaacccc
caggtgccttgcatcctggttggcccaggcaccggcatcgctcccttccgaagtttttgg
caacagcgacaatttgacatccaacacaaaggaatgaatccgtgccccatggttctggtc
ttcgggtgtcgacaatccaagatagatcatatctacagagaggagaccctgcaggccaag
aacaagggcgtcttcagagagctgtacactgcctactcccgggaacccgacaggccaaag
aaatatgtacaggacgtgctgcaggaacagctggccgagtctgtgtaccgcgccctgaag
gagcaaggaggccatatttatgtctgcggggacgttaccatggccgctgatgtcctcaaa
gccatccagcgcataatgacccagcaggggaaactctcggaggaggatgctggtgtgttc
atcagcaggctgagggatgacaaccggtaccacgaggacatctttggggtcaccctcaga
acatatgaagtgaccaaccgccttagatctgagtccatcgccttcattgaagagagcaaa
aaagacacagatgaggttttcagctcctaa

DBGET integrated database retrieval system