KEGG   Mus musculus (mouse): 18127
Entry
18127             CDS       T01002                                 

Gene name
Nos3, 2310065A03Rik, Nos-3, eNOS, ecNOS
Definition
(RefSeq) nitric oxide synthase 3, endothelial cell
  KO
K13242  nitric-oxide synthase, endothelial [EC:1.14.13.39]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04371  Apelin signaling pathway
mmu04611  Platelet activation
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    18127 (Nos3)
   00330 Arginine and proline metabolism
    18127 (Nos3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    18127 (Nos3)
   04371 Apelin signaling pathway
    18127 (Nos3)
   04066 HIF-1 signaling pathway
    18127 (Nos3)
   04020 Calcium signaling pathway
    18127 (Nos3)
   04071 Sphingolipid signaling pathway
    18127 (Nos3)
   04022 cGMP-PKG signaling pathway
    18127 (Nos3)
   04151 PI3K-Akt signaling pathway
    18127 (Nos3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18127 (Nos3)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    18127 (Nos3)
   04921 Oxytocin signaling pathway
    18127 (Nos3)
   04926 Relaxin signaling pathway
    18127 (Nos3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18127 (Nos3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    18127 (Nos3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18127 (Nos3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     18127 (Nos3)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 18127
NCBI-ProteinID: NP_032739
MGI: 97362
Ensembl: ENSMUSG00000028978
Vega: OTTMUSG00000024082
UniProt: P70313 Q8C5P3
Position
5 A3; 5 11.32 cM
AA seq 1202 aa
MGNLKSVGQEPGPPCGLGLGLGLGLCGKQGPASPAPEPSQAPAPPSPTRPAPDHSPPLTR
PPDGPRFPRVKNWEVGSITYDTLSAQAQQDGPCTSRRCLGSLVFPRKLQSRPTQGPSPTE
QLLGQARDFINQYYNSIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNA
PRCVGRIQWGKLQVFDARDCRTAQEMFTYICNHIKYATNRGNLRSAITVFPQRCPGRGDF
RIWNSQLIRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRFDVLPLLLQAPDEPPE
LFTLPPEMVLEVPLEHPTLEWFAALGLRWYALPAVSNMLLEIGGLEFPAAPFSGWYMSSE
IGMRDLCDPHRYNILEDVAVCMDLDTRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHH
AATASFMKHLENEQKARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWK
GSAAKGAGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQQLGRL
FRKAFDPRVLCMDEYDVVSLEHEALVLVVTSTFGNGDPPENGESFAAALMEMSGPYNSSP
RPEQHKSYKIRFNSVSCSDPLVSSWRRKRKESSNTDSAGALGTLRFCVFGLGSRAYPHFC
AFARAVDTRLEELGGERLLQLGQGDELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAAR
DIFSPKRSWKRQRYRLSTQAESLQLLPGLTHVHRRKMFQATILSVENLQSSKSTRATILV
RLDTGGQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPPSTEPVAVEQLEKGSPGGPP
PGWVRDPRLPPCTLRQALTYFLDITSPPSPRLLRLLSTLAEESSEQQELEALSQDPRRYE
EWKWFSCPTLLEVLEQFPSVALPAPLILTQLPLLQPRYYSVSSAPSAHPGEIHLTIAVLA
YRTQDGLGPLHYGVCSTWMSQLKAGDPVPCFIRGAPSFRLPPDPNLPCILVGPGTGIAPF
RGFWQDRLHDIEIKGLQPAPMTLVFGCRCSQLDHLYRDEVLDAQQRGVFGQVLTAFSRDP
GSPKTYVQDLLRTELAAEVHRVLCLEQGHMFVCGDVTMATSVLQTVQRILATEGGMELDE
AGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLRGAVPWSFDPPGPEIP
GS
NT seq 3609 nt   +upstreamnt  +downstreamnt
atgggcaacttgaagagtgtgggccaggagcctgggccaccctgtggcctagggctcggg
ctgggtttagggctgtgcggcaagcagggcccagcctctccagcaccggagcctagccag
gcgccagcacccccgtccccaacccgaccagcaccagaccacagccccccgctaacccgg
cccccagacggacccaggtttcctcgagtaaagaattgggaagtgggcagcatcacctac
gacaccctcagtgcccaggctcagcaggatgggccctgtacctcaagacgctgcttggga
tccctggtgtttccaaggaagttacagagccggcccacccagggcccttcacccactgag
cagctattgggtcaagcccgggacttcatcaatcagtactataactccatcaaaaggagt
ggctcccaggctcatgagcagcggcttcaggaagtggaggctgaggtggcagccacaggc
acctaccagctccgggagagcgagctggtgtttggggccaagcaggcctggcgcaatgct
ccccgctgtgtgggccggatccagtggggaaagctgcaggtatttgatgctcgggactgc
aggactgcacaggaaatgttcacctacatctgtaaccacattaaatacgcaacaaataga
ggcaatcttcgttcagccatcacagtgttcccccagcgctgccctggccggggagacttc
cggatctggaacagccagctgatacgctatgcgggctataggcagcaggatggctccgtg
cgaggggaccccgccaacgtggagatcactgagctctgtatccaacatggctggacccca
ggaaatggccgctttgatgtgctgcccctgttactccaggctcctgatgagcccccagaa
ctcttcactctgcccccagagatggtcctcgaggtgcctctggagcaccccacgctcgag
tggtttgctgcccttggcctgcgctggtatgccctcccagctgtgtccaacatgctgcta
gaaatcgggggcctggagtttcctgctgcccctttcagcggctggtacatgagttcagag
attggcatgagggacctgtgtgaccctcaccgctacaacatacttgaggatgtggctgtg
tgcatggatctggacaccaggacaacctcatccctgtggaaagacaaggcagcggtggaa
attaatgtggccgtgttgcacagttaccagctggccaaagtgaccatagtggaccaccac
gccgccacagcctccttcatgaagcacctggaaaatgagcagaaggccagagggggctgc
cctgccgattgggcctggattgtgccccccatctcaggcagcctaactcctgtcttccat
caagagatggtcaactatttcctgtcccctgccttccgctaccagccagacccctggaag
ggaagtgcagcaaagggggcaggcatcaccaggaagaagacctttaaggaagtagccaat
gcagtgaagatctctgcctcactcatgggcacggtgatggcgaagcgtgtgaaggcaacc
attctgtatggctctgagactggccgggcccagagctacgcacagcagctgggaagactc
ttccggaaggcgtttgatccccgggtcctgtgcatggatgagtatgatgtggtgtcccta
gagcacgaggcactggtgttggtggtgaccagcacatttggcaatggggatcctccggag
aatggagagagctttgcagcagcgctcatggaaatgtcaggcccgtacaacagctcccct
aggcctgagcagcacaagagctacaaaatccgattcaacagtgtctcctgctcagaccca
ctggtatcctcttggcggcgcaagaggaaggagtctagcaacacagacagtgcaggagcc
ctgggcaccctcaggttctgtgtgtttgggctgggctcccgagcatacccccacttctgt
gcctttgctcgagcggtggacacaaggctggaggagctgggcggggagcgactactgcag
ctgggccaaggtgatgagctctgtggccaggaggaggctttccgaggctgggcccaggcc
gccttccaggctgcctgtgaaaccttctgtgtgggagaagatgccaaagctgctgcccga
gatatcttcagccccaaacgcagctggaagcgccagaggtaccggctgagtacccaggct
gagagcctgcaattactaccagggctgactcacgtgcacaggcggaagatgttccaggct
acaatcctctctgtggaaaacctacagagcagcaaatccacccgagccacgatcctggtg
cgtctggacaccggaggccaggagggactgcagtaccagccaggggaccacataggtgtg
tgcccacccaaccgtcctggcctagtggaggcactgctgagccgagtggaggaccctccg
ccatccacagaacctgtggctgtggaacaactggagaaaggcagccctggtggccctccc
cccggctgggtacgggacccccggctacccccatgtacgctgcggcaggctctcacctac
ttcctggacatcacttccccgcctagtcctcgcctccttcgactgctcagcaccctggca
gaagagtccagcgaacagcaggagctagaggctctcagccaggacccccggcgctacgaa
gaatggaagtggttcagctgccccacactgctagaggtgctggagcaatttccttcagtg
gcactgcctgccccgctgatcctcacccagctgcccttgctccagccccggtactactct
gtcagttcagcacccagcgcccacccaggagagatccacctcaccatagctgtgctggct
tacagaacccaggatgggctgggccctctgcactacggtgtctgctccacgtggatgagc
cagctcaaggcgggagatccagtgccctgcttcatcaggggggctccctccttccggctg
ccacctgatcctaacttgccctgcatcctggtgggcccagggactggcattgcacccttc
cggggattctggcaagacagactacacgacattgagatcaaagggctacaacctgccccc
atgactttggtgtttggctgccgatgctcccaactggaccatctctaccgggacgaggta
ctggacgcccagcagcgtggggtgtttggacaagtcctcaccgccttttccagggatcct
ggcagccccaagacctacgtgcaagacctcctgaggacagagctagccgcggaggttcac
cgtgtgctgtgccttgagcaaggacatatgtttgtctgcggcgatgtcactatggcaacc
agcgtcctgcaaaccgtgcagagaattctggcaacagagggcggcatggagctggatgaa
gccggtgacgtcatcggcgtgctgcgggatcagcaacgctaccacgaggacattttcgga
ctcacattgcgcacccaggaggtgacaagccgcatacgcacccagagcttttctttgcag
gagcgacagctgaggggcgcagtgccctggtcctttgacccgcctggcccagaaatacct
ggttcctga

DBGET integrated database retrieval system