KEGG   Mus musculus (mouse): 18174
Entry
18174             CDS       T01002                                 

Symbol
Slc11a2, DCT1, DMT1, Nramp2, mk, van
Name
(RefSeq) solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2
  KO
K21398  natural resistance-associated macrophage protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04216  Ferroptosis
mmu04978  Mineral absorption
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    18174 (Slc11a2)
  09143 Cell growth and death
   04216 Ferroptosis
    18174 (Slc11a2)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    18174 (Slc11a2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18174 (Slc11a2)
   05012 Parkinson disease
    18174 (Slc11a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18174 (Slc11a2)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC11: Proton-coupled metal ion transporter
   18174 (Slc11a2)
SSDB
Motif
Pfam: Nramp
Other DBs
NCBI-GeneID: 18174
NCBI-ProteinID: NP_032758
MGI: 1345279
Ensembl: ENSMUSG00000023030
Vega: OTTMUSG00000033264
UniProt: P49282
Position
15:complement(100285779..100322090)
AA seq 568 aa
MVLDPKEKMPDDGASGDHGDSASLGAINPAYSNSSLPHSTGDSEEPFTTYFDEKIPIPEE
EYSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWVLLLATIVGLLLQR
LAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELAIIGSDMQEVIGSAIAINLLSAGRV
PLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITIMALTFGYEYITVKPSQSQVLRGM
FVPSCPGCRTPQVEQAVGIVGAVIMPHNMYLHSALVKSRQVNRANKQEVREANKYFFIES
CIALFVSFIINVFVVSVFAEAFFEKTNKQVVEVCKNNSSPHADLFPSDNSTLAVDIYKGG
VVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVILTRSIAI
IPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSEFSNGIGWRIAG
GILVLIVCSINMYFVVVYVQELGHVALYVVAAVVSVAYLTFVFYLGWQCLIALGLSFLDC
GRSYRLGLTAQPELYLLNTVDADSVVSR
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggtgttggatcctaaagaaaagatgccagacgatggcgcttctggggaccatggagac
tctgccagccttggcgccatcaaccctgcctacagcaactcatccctcccacattccact
ggagactctgaggagcccttcaccacctactttgatgagaaaatccccattcctgaggag
gagtactcttgttttagctttcgtaaactctgggcgttcacggggcctggctttcttatg
agcattgcctacctagacccaggaaacatcgaatctgatttgcagtctggagcagtggct
ggatttaagctgctctgggtgctcctcttggccaccattgtggggctgctgctccagcgc
cttgcagcgagacttggagtggtcaccggcttgcatcttgctgaagtatgtcaccgtcag
tatcccaaggtcccacggatcatcctgtggctgatggtggagttggcaatcattggttct
gacatgcaggaagtcattggctcagccatcgccatcaatctcctgtctgcaggaagggtc
cccctgtggggcggagtcctcatcaccatcgcagacacttttgtgtttctttttttggac
aaatatggcttgcggaagctggaagcgttttttggctttctcatcactatcatggccctc
acgtttggatatgagtacattacagtgaagcccagccagagccaagtactcaggggcatg
ttcgtgccgtcctgtccagggtgccgcacccctcaggtggagcaggcggtgggcatcgtg
ggagctgtgatcatgccgcacaacatgtacctgcattctgccttagtcaagtctagacag
gtgaatcgggccaataagcaggaagtgcgggaagccaataagtacttcttcatcgagtcc
tgcatcgcgctctttgtttccttcatcatcaatgtctttgtcgtgtccgtctttgctgaa
gcattttttgagaaaaccaacaagcaggtggttgaagtctgcaaaaataacagcagcccc
catgctgacctctttcccagtgacaactctactctggctgtggacatctacaaagggggt
gttgtgcttggatgttacttcgggcctgcagctctctacatctgggcagtggggatcctg
gctgccggtcagagctccaccatgactggaacctattctggccagtttgtcatggaggga
ttcctgaacctaaaatggtcgcgctttgcccgagtgatcctgacccggtctatcgccatc
atccccaccctgctcgtcgctgtcttccaggatgtggagcacctaacggggatgaatgac
ttcctgaatgtcctgcagagcttacagctcccctttgctctcatacccatcctcacgttc
acaagcctgcggccagtgatgagtgagttttccaatggaataggctggaggattgccggt
ggcatcctggtcctgatcgtctgctccatcaacatgtactttgtagtggtttatgtccag
gagctagggcatgtggcactctatgtggtggctgcagtggttagcgtggcttatttgacc
tttgtgttctacttgggttggcagtgtttgattgcattgggtctgtctttcctggactgt
ggacgctcgtaccgcctgggactgaccgctcagcctgaactctatcttctgaacaccgtg
gatgctgactcagtggtgtccagatga

DBGET integrated database retrieval system