KEGG   Mus musculus (mouse): 18230
Entry
18230             CDS       T01002                                 

Gene name
Nxn, l11Jus, l11Jus13
Definition
(RefSeq) nucleoredoxin
  KO
K17609  nucleoredoxin [EC:1.8.1.8]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    18230 (Nxn)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.8  protein-disulfide reductase
     18230 (Nxn)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     18230 (Nxn)
SSDB
Motif
Pfam: Thioredoxin_8 Thioredoxin_2 AhpC-TSA Thioredoxin Thioredoxin_6 Redoxin Thioredoxin_7 Glutaredoxin SCO1-SenC
Other DBs
NCBI-GeneID: 18230
NCBI-ProteinID: NP_032776
MGI: 109331
Ensembl: ENSMUSG00000020844
Vega: OTTMUSG00000006232
UniProt: P97346
Position
11 B5; 11 45.92 cM
AA seq 435 aa
MSGFLEELLGDKLVTGGGEEVDVHSLGARGIALLGLYFGCSLSAPCAQLSASLAAFYGRL
RGDAAAGPGAGAGAGAAAEPEPRHRLEIVFVSSDQDQRQWQDFVRDMPWLALPYKEKHRK
LKLWNKYRVSNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLR
NNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQEFEIIFVSADRSE
ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDE
DCREFPWHPKPVLELSDSNAVQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYK
AKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVET
FVNDFLAEKLKPEPI
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtcgggcttcctggaggagctgctgggagacaagctggtgacgggcggtggcgaggag
gtggacgtgcattcgctgggcgcccgcggcatcgcgctgctggggctctacttcgggtgc
agcctgagcgccccctgcgcgcagctcagcgccagcctggccgccttctacggtcgcctg
cgaggggacgcggcggccgggccgggggccggggcgggggccggcgcagccgcggagcca
gagccccggcaccgcctggagatcgtcttcgtgtcttcggaccaagaccagcggcagtgg
caggacttcgtgcgggacatgccatggctggcgctgccctacaaggagaagcaccggaag
cttaaactttggaacaaataccgagtctccaacattccatcgctaatattcctagacgcc
accacagggaaggttgtgtgcaggaatgggctcctggtgatccgagatgacccggaaggt
ctggaattcccttggggacctaaacccttccgggaagttattgcggggcccttgcttaga
aataacgggcagtcgctggagagcagcagcctggaggggtctcacgtgggagtctatttc
tctgcacactggtgtccaccctgccgaagccttaccagagtgctggtggaatcctaccgg
aagatcaaggaggcaggccaggagtttgagatcatcttcgttagtgcagacaggtcagag
gagtctttcaaacagtactttagtgagatgccatggctcgctgtcccctacactgatgag
gcccggcggtctcgtctcaaccgactgtatggaatccaaggcatccccacgctcatcgtg
ctggacccgcagggggaggtgatcactcggcagggtcgggtggaggtgctcaatgacgag
gactgcagggagttcccgtggcacccgaagcccgtgctggagctctctgactccaacgct
gtgcagctcaacgagggcccctgcctcgtcctttttgtagactctgaggacgacggagag
tccgaggcagccaaacagctgatccagccaatagctgagaagatcattgccaagtacaaa
gccaaagaagaggaggcgccgctgttgttctttgtggccggggaggatgacatgactgac
tccctgagagattacaccaacctgcctgaggcggcgcctctgctcaccattctggacatg
tcagcccgggccaagtacgtgatggatgtagaagagatcaccccagccattgtggagact
tttgtgaatgacttcctagcagaaaaactcaagcctgagcccatctag

DBGET integrated database retrieval system