KEGG   Mus musculus (house mouse): 18294
Entry
18294             CDS       T01002                                 
Symbol
Ogg1, Mmh
Name
(RefSeq) 8-oxoguanine DNA-glycosylase 1
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    18294 (Ogg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18294 (Ogg1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     18294 (Ogg1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     18294 (Ogg1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     18294 (Ogg1)
SSDB
Motif
Pfam: OGG_N HhH-GPD HHH HHH_5
Other DBs
NCBI-GeneID: 18294
NCBI-ProteinID: NP_035087
MGI: 1097693
Ensembl: ENSMUSG00000030271
UniProt: O08760 Q3UIL3
Structure
Position
6:113303871..113311838
AA seq 345 aa
MLFRSWLPSSMRHRTLSSSPALWASIPCPRSELRLDLVLASGQSFRWKEQSPAHWSGVLA
DQVWTLTQTEDQLYCTVYRGDDSQVSRPTLEELETLHKYFQLDVSLAQLYSHWASVDSHF
QRVAQKFQGVRLLRQDPTECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPNLHALAGPEAETHLRKLGLGYRARYVRASAKAILEEQGGPAWLQQLRVAPYEEAHKAL
CTLPGVGAKVADCICLMALDKPQAVPVDVHVWQIAHRDYGWHPKTSQAKGPSPLANKELG
NFFRNLWGPYAGWAQAVLFSADLRQPSLSREPPAKRKKGSKRPEG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgttattccgttcctggctgcctagcagcatgagacatcgcaccctaagctccagcccg
gccctctgggcctctatcccgtgtccacgctctgagctgcgtctggacttggttttagct
tctggacagtccttccggtggaaggagcagagccctgctcactggagtggcgtgctggca
gatcaagtatggacactgactcagacggaggaccagctctattgcactgtgtaccgagga
gacgacagccaggtcagcaggcccaccctagaggagctggaaaccctacacaagtacttt
cagctagatgtcagcctggcacagctgtatagccactgggcttctgtagactcccacttc
caaagagtggcccagaaattccaaggtgtgagactgctgagacaagaccccactgagtgc
cttttctctttcatctgttcctccaacaacaacattgctcgcattactggcatggtggaa
cggctctgccaggcctttggacctcgactcattcagcttgatgatgtcacttatcatggc
ttcccaaacctccatgccctggctggtccagaagcagagactcacctgaggaagttgggc
ctggggtaccgtgcccgctatgtacgtgccagtgccaaagccatcctcgaagagcaaggt
gggccagcttggctgcagcagcttcgagtggccccttatgaagaggcccacaaggccctc
tgcaccctgcccggggtgggcgccaaggtggctgactgcatctgcttaatggcccttgac
aaaccccaggctgtgcccgtggatgtccatgtatggcagattgcccatcgtgactacggc
tggcatcctaagacatcccaggctaagggcccgagccctttggccaacaaagaactggga
aactttttccggaatctgtggggaccttatgctggctgggcccaagcagtgctgttcagt
gctgaccttcgccaaccaagcctgtctcgggagccaccagcaaagcgcaaaaagggatct
aagaggccagagggctag

DBGET integrated database retrieval system