KEGG   Mus musculus (house mouse): 18682
Entry
18682             CDS       T01002                                 
Symbol
Phkg1, Phkg
Name
(RefSeq) phosphorylase kinase gamma 1
  KO
K00871  phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04910  Insulin signaling pathway
mmu04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    18682 (Phkg1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    18682 (Phkg1)
   04922 Glucagon signaling pathway
    18682 (Phkg1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18682 (Phkg1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     18682 (Phkg1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  PHK family
   18682 (Phkg1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase Kinase-like Kdo APH ABC1 RIO1 FTA2 Pkinase_fungal YidD YrbL-PhoP_reg Choline_kinase DUF2806 Bac_DNA_binding
Other DBs
NCBI-GeneID: 18682
NCBI-ProteinID: NP_035209
MGI: 97579
Ensembl: ENSMUSG00000025537
UniProt: P07934
Position
5:complement(129892272..129907953)
AA seq 388 aa
MTRDDALPDSHSAQTFYENYEPKEILGRGVSSVVRRCIHKPTCQEYAVKIIDITGGGSFS
SEEVQELREATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLTEKV
TLTEKETRKIMRALLEVICTLHKLNIVHRDLKPENILLDDNMNIKLTDFGFSCQLQPGEK
LREVCGTPSYLAPEIIQCSMDDGHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLR
MIMDGKYQFGSPEWDDYSDTVKDLVSRFLVVQPQDRCSAEEALAHPFFQEYVVEEVRHFS
PRGKFKVICLTVLASVKIYYQYRRVKPVTREIVIRDPYALRPLRRLIDAYAFRIYGHWVK
KGQQQNRAALFENTPKAVLLSLAEEEDF
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgacccgggatgacgccctccctgactcgcattctgcacagactttctacgagaactat
gagcccaaggagatcctgggcaggggagtcagcagtgtggtcaggcgctgcatccacaaa
cccacatgccaggaatacgcagtgaaaatcattgacatcaccggaggaggaagctttagc
tctgaggaggtacaggagcttcgggaagccaccctgaaggaggtggacatcctgcagaag
gtctcgggacaccccaacatcatacagctgaaggacacttacgagaccaacactttcttc
ttcttggtatttgatctgatgaagagaggggaactctttgactatctcactgagaaggtc
accttaaccgagaaggaaaccagaaagatcatgcgggccctgctggaggtgatctgtacc
ctgcacaaactcaacattgtccatcgggacctgaagccggagaatatccttttggatgac
aacatgaatataaagctcacagacttcgggttttcctgccagctgcagccaggagagaag
ctccgagaggtttgtgggactcccagttatctggcccctgaaatcatacagtgctccatg
gacgacggccatcctggctatgggaaggaggtggacatgtggagcacaggcgtcatcatg
tacactctgctggctggctccccgcctttctggcaccggaagcaaatgctgatgttgcgg
atgatcatggacggcaaataccagtttggctcaccagagtgggatgactactctgacaca
gtgaaagacttggtgtctcgattcttggtggtgcaacctcaggaccgctgctcggcggaa
gaggccttggcacaccctttctttcaggagtacgtagtagaagaagtacggcacttcagc
ccccgagggaagttcaaggtgatctgtctaactgtgctggcatcagtaaagatctactac
cagtaccgtcgggtgaagccggtaaccagggagatcgtcatccgagacccctacgccctt
cggccgctgcggaggctcattgacgcctatgctttccgtatctacggccactgggtgaag
aaagggcaacagcagaacagagccgccctcttcgagaacacgcccaaggctgtgctcctc
tccttggctgaggaggaggacttctga

DBGET integrated database retrieval system