KEGG   Mus musculus (house mouse): 19011
Entry
19011             CDS       T01002                                 
Symbol
Endou, Pp11r, Tcl-30
Name
(RefSeq) endonuclease, polyU-specific
  KO
K14648  poly(U)-specific endoribonuclease [EC:3.1.-.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    19011 (Endou)
SSDB
Motif
Pfam: XendoU Somatomedin_B EndoU_bacteria
Other DBs
NCBI-GeneID: 19011
NCBI-ProteinID: NP_001162164
MGI: 97746
Ensembl: ENSMUSG00000022468
UniProt: Q3V188
Position
15:complement(97608896..97629286)
AA seq 412 aa
MKARVPFIVAMLCGLAWAGNLESCASRCHEKFNRDAVCQCDRRCPQHDDCCDDYEHLCTA
EEGPPEPEAFLDPEDKIPTSHLYSAPSSCQGRCREAYDKHHPCHCNDRCPEFGNCCEDFD
SLCGGDHEGFSHSSDAVTKEELESISETIYRVDTNKAQKEDIVLNSQNRISPSETGNQVD
RSPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLEEQGVFLREVMKTAV
MKELYSFLHHQNRYSSEQEFVDDLKNMWFGLYSRGNDEGDSSGFEHVFSGEVKKGKVTGF
HNWIRFYLQEKEGLLDYYSHNYDGPWDSYPDVLAMQFNWDGYYKEVGSVFIGSSPEFEFA
LYSLCFITRPGKKCHLSLGGYPLAIQTYTWDKTTYGNGKKYIATAYVVSSSQ
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaaggcccgtgttccttttatagtggctatgctctgtggtctagcctgggctggaaac
ctggagtcgtgcgcatctcgctgtcatgagaaatttaaccgggatgctgtctgccagtgt
gatcgccggtgtccccagcatgatgactgctgtgacgactatgaacatctgtgcactgct
gaagaaggacccccagagccagaggcattcctggatccagaggacaagatcccaaccagc
cacctctactccgcaccgagctcctgccagggccgctgccgggaagcctacgacaagcac
cacccttgccactgtaatgaccgctgcccagagtttggaaactgctgtgaggattttgac
agtctgtgtggtggtgatcatgagggtttctcccacagcagcgatgccgtcactaaggag
gagcttgagagcatctccgagaccatctacagggtagataccaacaaagcccagaaggaa
gacattgtgctcaacagtcagaaccggatctccccatcagagacggggaaccaagtggat
cgaagcccagagccgctcttcacttacgtcaacgagaagctgttctccaagcctacctat
gcagcctttatcaacttactcaacaattaccagcgggccacaggccacggggagcatttc
agtgcccagcaactggaggagcagggtgtcttcctcagggaggtcatgaagacggctgtc
atgaaggaactctatagctttctccatcaccaaaaccgttacagctcagaacaagagttt
gtggacgatttgaagaacatgtggtttgggctgtactcgagaggcaatgatgaaggggac
tcgagtggctttgaacatgtcttctctggcgaagtgaagaaaggcaaggtcactggcttt
cataactggatccgcttctacctgcaggagaaggagggtctgctggactactacagtcac
aactacgacgggccctgggactcctaccccgatgtcctggccatgcagttcaattgggat
ggctactacaaagaagtgggctcggtcttcattggcagcagccctgagttcgagtttgcc
ctttactctctgtgcttcatcaccaggccaggcaaaaagtgccatctgagcctgggtggc
tatcctctggccatccagacctacacctgggataagaccacctacggaaatggcaagaag
tacattgccacagcctacgtggtgtcttcttcccaatag

DBGET integrated database retrieval system