KEGG   Mus musculus (mouse): 19069
Entry
19069             CDS       T01002                                 

Symbol
Nup88, Nup84, Prei2
Name
(RefSeq) nucleoporin 88
  KO
K14318  nuclear pore complex protein Nup88
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    19069 (Nup88)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    19069 (Nup88)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19069 (Nup88)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     19069 (Nup88)
SSDB
Motif
Pfam: Nup88 FBA_1
Other DBs
NCBI-GeneID: 19069
NCBI-ProteinID: NP_001076800
MGI: 104900
Ensembl: ENSMUSG00000040667
Vega: OTTMUSG00000006081
UniProt: Q8CEC0 Q5QNU0 Q8BQF0
Position
11:complement(70833884..70860799)
AA seq 753 aa
MAAAVGPLGDGELWQSWLPNHVVFLRLREGVRNQSPAEAEKPAASTSPSCPSLPPHLPTR
NLVFGLGGELFLWDAEGSAFLVVRLRGPSGGGVEPPLSQYQRLLCINPPLFEIHQVLLSP
TQHHVALIGSKGLMALELPQRWGKDSEFEGGKATVNCSTIPIAERFFTSSTSLTLKHAAW
YPSEMLDPHIVLLTSDNVIRIYSLREPQTPTKVIVLSEAEEESLILNKGRAYTASLGETA
VAFDFGPLVTVSKNIFEQKDRDVVAYPLYILYENGETFLTYVSLLHSPGNIGKLLGPLPM
HPAAEDNYGYDACAILCLPCVPNILVIATESGMLYHCVVLEGEEEDDQTLEKSWDPRADF
IPSLYVFECVELELALKLASGEDDPFASDFSCPIKLHRDPKCPSRYHCSHEAGVHSVGLT
WIHKLHKFLGSDEEDKDSLQELTAEQKCFVEHILCTKPLPCRQPAPIRGFWIVPDILGPT
MICITSTYECLIRPLLSTVHPASPPLLCTQEDAEVAESPLRILAETPDSFEKHIKRILQR
SAANPAFLKNCSARSSEKDLAPPPEECLQLISRATQVFREQYILKQDLAKEEIQRRVKLL
CDQKRKQLEDLNYCREERVSHLFRKSLREMAERLADKYEEAKEKQEDIMNRMKKVLHSFH
AQLPVLSDSERDMKKELQLIPDQLRHLGNAIKQVTMKKDYQQRKMEKVLSPQKPTITLSA
YQRKCIQSILKEEGEHIREMVKQINDIRNHVTF
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggcggctgccgtggggcccttgggcgatggggagctgtggcagagctggcttcctaac
cacgtcgtgttcttgcggctccgcgagggcgtaagaaaccagagtccagccgaagcggag
aagccagcggcttcgacttcaccctcgtgcccgtctctgccgccgcatttgccgacgaga
aacctggtcttcggcctcggaggggaactgtttctgtgggacgcagaaggcagcgccttc
ttggtggttcgccttcgaggccccagcggtggtggcgtggagcctcctctctcccagtat
cagagattactctgcattaatccacccttgtttgaaatccatcaagtcttgttgagtcca
acccaacatcatgtagcacttatcggaagtaaaggacttatggcattagaattacctcag
aggtgggggaaggactctgaatttgaaggtggaaaagcaactgtgaattgtagcaccatc
ccgattgctgagagatttttcaccagctctacctctctgactctgaagcatgctgcatgg
tatccaagtgagatgctggatccccacatagtgctgttgacatcagacaacgtgataaga
atttattctctccgtgagccccagacacccactaaggtgattgtactttcagaagcagaa
gaggaaagtttaatactcaataaaggaagagcatatacagcgtctctaggagagactgca
gtggcgtttgacttcgggcccctggtaaccgtctcaaagaatatatttgaacagaaagac
agagatgtggtggcgtatccactgtacatcctgtatgagaatggggagaccttccttacc
tacgtgagcctgttacacagcccagggaatattgggaagctgttgggcccactgcctatg
catcctgcagctgaagataactacggttacgatgcctgtgctatactctgtttgccctgt
gttccaaatatcttagtaattgcgactgagtcaggaatgctgtaccactgtgttgtacta
gagggagaagaagaagatgaccaaacgttagaaaagtcctgggatcccagggctgacttc
atcccttctctgtacgtgtttgagtgtgttgagttagagcttgccctgaagctggcatct
ggagaggacgatccctttgcctctgacttttcctgcccaattaaactgcacagagatccc
aagtgtccttcgagataccactgcagccatgaagctggcgtgcacagtgtggggctgact
tggattcacaaactgcacaaatttcttggatcggatgaagaagataaggatagtttacaa
gaactcactgctgagcagaaatgctttgtggagcacattctttgtacaaagccattgccg
tgcaggcagccagctccaattcgaggattctggatcgtcccagacatcctggggcccaca
atgatctgcatcaccagtacctatgaatgtctcatacggcctttattaagtacagtccac
ccagcatctcctcccctgctctgtacccaagaagatgctgaagttgcagagtctccactg
cgcattctggctgaaactccagactcctttgagaagcatattaaaagaatcttgcagcgt
agtgctgccaacccagcatttctcaaaaactgttctgcaagatcatctgaaaaggatttg
gctccccctcccgaggagtgtcttcagcttatcagcagagccacccaggtgttccgagaa
cagtacattctcaagcaggacctggccaaggaggagattcagcggagggtcaaattatta
tgtgaccaaaagaggaaacaactcgaagatctcaattactgtcgagaggaaagggtttct
catctcttcaggaaaagtctccgggaaatggctgagcgcttagctgacaaatatgaggaa
gccaaagaaaaacaagaagatatcatgaacaggatgaaaaaagtgcttcacagttttcat
gctcagctcccagttctctctgacagtgagagagacatgaagaaagagttacagctgata
cctgatcaactgcgacatctaggcaacgccatcaaacaggttactatgaaaaaagattat
caacagcggaagatggaaaaagtgctgagtcctcagaaacccaccattactctcagtgcc
taccagcgaaagtgcattcagtccatcctgaaagaagagggtgaacacataagggaaatg
gtgaagcaaatcaatgacatccgaaatcatgtcaccttctga

DBGET integrated database retrieval system