KEGG   Mus musculus (mouse): 19116Help
Entry
19116             CDS       T01002                                 

Gene name
Prlr, AI987712, Pr-1, Pr-3, Prlr-rs1
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04080  Neuroactive ligand-receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    19116 (Prlr)
   04151 PI3K-Akt signaling pathway
    19116 (Prlr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19116 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    19116 (Prlr)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    19116 (Prlr)
Cytokine receptors [BR:mmu04050]
 Interleukin receptor families
  Prolactin receptor family
   19116 (Prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind IL6Ra-bind fn3
Motif
Other DBs
NCBI-GeneID: 19116
NCBI-ProteinID: NP_035299
MGI: 97763
Ensembl: ENSMUSG00000005268
Vega: OTTMUSG00000023932
UniProt: Q08501 Q8C5N1 Q3TNP6
Position
15 A1; 15 5.23 cM
AA seq 608 aa AA seqDB search
MSSALAYMLLVLSISLLNGQSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYS
KEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDTTVWIIVAVLS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTS
DCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCE
EPQAYPPAFHIPEITEKPENPEANIPPTPNPQNNTPNCHTDTSKSTTWPLPPGQHTRRSP
YHSIADVCKLAGSPGDTLDSFLDKAEENVLKLSEDAGEEEVAVQEGAKSFPSDKQNTSWP
PLQEKGPIVYAKPPDYVEIHKVNKDGVLSLLPKQRENHQTENPGVPETSKEYAKVSGVTD
NNILVLVPDSRAQNTALLEESAKKVPPSLEQNQSEKDLASFTATSSNCRLQLGRLDYLDP
TCFMHSFH
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgcacttgcttacatgctgcttgtcctcagcatcagcctcctgaatggacag
tcaccacctggaaaacctgaaatccacaaatgtcgttcccctgacaaggaaacattcacc
tgctggtggaatcctgggtcagatggaggactccccaccaattattcattgacatacagc
aaagaaggagagaaaaacacctatgaatgtccagactacaaaaccagtggccccaattcc
tgtttctttagcaagcagtacacttccatatggaaaatatacatcatcacagtaaatgcc
acgaacgaaatgggaagcagtacctcggatccactttatgtggatgtgacttacattgtt
gaaccagagcctcctcggaacctgactttagaagtgaaacaactaaaagacaaaaaaaca
tatctgtgggtaaaatggttgccacctaccataactgatgtaaaaactggttggtttaca
atggaatatgaaattcgattaaagtctgaagaagcagatgagtgggagatccacttcaca
ggtcatcaaacacaatttaaggtttttgacttatatccaggacaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggggccaggagaaatctattgaa
ataccaaatgacttcaccttgaaagacacaactgtgtggatcattgtggccgttctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggttatagcatgatgacc
tgcatctttccaccagttccggggccaaaaataaaaggatttgatactcatctgctagag
aagggcaagtctgaagaactgctgagtgccttggggtgccaagactttccccccacttct
gactgtgaggacttgctggtggagttcttggaagtggatgacaatgaggacgagcggcta
atgccatcccattccaaagagtatccgggtcaaggtgttaaacccacacacctagatcct
gacagtgactctggtcatggaagctatgacagccattctcttttgtctgaaaagtgtgag
gagccccaggcctacccccctgccttccacatccctgagatcactgagaagccagagaat
cctgaggcaaatattcctcccaccccaaatccccaaaataacacccccaattgtcataca
gatacatccaaatctacaacatggcctttaccacctggccaacacacgcgcagatctcct
taccacagcattgccgatgtgtgcaagctagctggaagtcctggagatacactggactct
ttcttggacaaagcagaggaaaatgttctaaagttgtctgaagatgctggagaggaagaa
gtggctgtgcaagaaggggccaaaagcttcccttctgacaaacaaaacacatcttggcca
ccactccaggagaaaggccccattgtctatgctaaacccccagattacgtggagattcac
aaagtcaacaaagacggagtgctatcattactccccaagcagagagaaaaccaccagaca
gaaaaccctggggttcctgaaaccagtaaggagtatgccaaggtatctggggtcacggat
aacaacatcctggtgttagtgccagactcacgagcccagaacacagctttgcttgaggaa
tcagccaagaaggttccaccatcgcttgaacagaaccaatctgagaaagatctggccagc
tttactgcaacctcaagcaactgcagactccaactgggcaggctggattacctggatcct
acgtgcttcatgcactcctttcactga

DBGET integrated database retrieval system