KEGG   Mus musculus (mouse): 19223
Entry
19223             CDS       T01002                                 

Gene name
Ptgis, Cyp8, Cyp8a1, P, Pg, Pgis
Definition
(RefSeq) prostaglandin I2 (prostacyclin) synthase
  KO
K01831  prostacyclin synthase [EC:5.3.99.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    19223 (Ptgis)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mmu00199]
    19223 (Ptgis)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.4  prostaglandin-I synthase
     19223 (Ptgis)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP8 family
   19223 (Ptgis)
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 19223
NCBI-ProteinID: NP_032994
MGI: 1097156
Ensembl: ENSMUSG00000017969
Vega: OTTMUSG00000001169
UniProt: O35074
Position
2; 2 H3
AA seq 501 aa
MSWAALLGLLAVLLLLLLLLSRRRARRPGEPPLDLGSIPWLGHALEFGRDAASFLTRMKE
KHGDIFTVLVGGRYVTVLLDPHSYDTVVWELRTRLDFHPYAIFLMERIFDLQLPNFNPSE
EKARMKPTLMHRDLQALTEAMYTNLRTVLLGDSTEAGSGWQETGLLEFSYNALLSAGYLT
LYGVEASPRTHESQAQDRVHSADVFHTFRQLDLLLPKLARGSLSAGDKDHACSVKNRLWK
LLSPARLASRADRSSWLESYLRHLEEMGVSEEMQARALVLQLWATQGNMGPTAFWLLLFL
LKNPEALAAVRAELKHTVWQAEQPVSQMTTLPQKILDSMPVLDSVLNETLRLTAAPFITR
EVMADLALPMADGREFSLRRGDRLLLFPFLSPQKDPEIYTEPEVFKYNRFLNPDGSEKKD
FYKDGKRLKNYNMPWGAGHNQCLGKSYAINSIKQFVVLLLTHFDLELGSEDTEVPEFDLS
RYGFGLMQPEEDVPIRYRARL
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgtcctgggctgctctgctcggcctcctggccgtgctattgctgttgctgctgctgctg
agccgccggcgcgcgcggagacctggtgagcctccgttggacctgggcagcatcccctgg
ctgggccatgccttggagtttgggagagatgctgccagcttccttaccaggatgaaggaa
aagcacggtgacatatttactgtgctggtggggggcagatacgtcactgttctcctggac
ccacactcttacgacacagtggtgtgggagctgcgtacacggctggacttccatccctat
gccatcttcctcatggagaggatttttgatctgcagcttccaaatttcaaccccagtgag
gagaaggccaggatgaagccgacgctcatgcacagagacctgcaggcgctcacagaagcc
atgtataccaaccttcgcacggtcctgctgggtgactccacagaagcaggcagtggctgg
caggagacaggtctccttgagttctcctacaacgccctgctcagcgccggctacctgacc
ctatatggagtggaggcctcaccacgcacccatgagagtcaggcccaagatcgtgtccac
tcagcggatgttttccataccttccgccagctggatctgctgctccccaaactggctcga
ggctccttgtcagcgggggataaagaccatgcatgcagtgtcaaaaaccgcctgtggaag
ctgctgtccccagccaggctggcctccagggctgaccggagcagctggctggagagttat
ctgagacatcttgaggagatgggggtgtcagaggagatgcaggcccgggctctggtgttg
cagctctgggccacacaggggaatatgggtcccacggccttctggctccttcttttcctc
ctcaagaatccggaagccctcgccgctgtccgtgcagagctgaagcacacggtctggcaa
gcagagcagcctgtttcacagatgaccacactcccacagaagattctagacagcatgcct
gtgctagacagtgtgctcaatgagacactccggctcacggctgcccccttcatcacccgt
gaggtcatggcagacctggccttgcctatggcagacgggagggaattctctcttcgacgt
ggtgaccgccttctcctctttcccttcctgagtccccagaaggacccagaaatctacaca
gagcctgaggtgtttaaatacaaccgattcttgaacccagatggatctgaaaagaaagat
ttttacaaagatgggaaacggctgaagaattacaacatgccatggggcgcagggcacaac
cagtgcctggggaagagttatgccatcaacagcatcaaacaatttgtcgtcctactgctg
actcatttcgacctggagctgggcagcgaggacacagaggttcctgagtttgacctcagc
agatatggcttcggtctgatgcagccagaggaagacgtgcccatccggtaccgtgccagg
ctgtga

DBGET integrated database retrieval system