KEGG   Mus musculus (mouse): 19252Help
Entry
19252             CDS       T01002                                 

Gene name
Dusp1, 3CH134, MKP1, Ptpn16, U19515, erp, mkp-1
Definition
(RefSeq) dual specificity phosphatase 1
  KO
K21278  dual specificity protein phosphatase 1 [EC:3.1.3.16 3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04726  Serotonergic synapse
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19252 (Dusp1)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    19252 (Dusp1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    19252 (Dusp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19252 (Dusp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19252 (Dusp1)
    3.1.3.48  protein-tyrosine-phosphatase
     19252 (Dusp1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    19252 (Dusp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 19252
NCBI-ProteinID: NP_038670
MGI: 105120
Ensembl: ENSMUSG00000024190
Vega: OTTMUSG00000020083
UniProt: P28563 Q3U8K3
Position
17 A3.3; 17 13.28 cM
AA seq 367 aa AA seqDB search
MVMEVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAM
GLEHIVPNAELRGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFF
LQGGYEAFSASCPELCSKQSTPTGLSLPLSTSVPDSAESGCSSCSTPLYDQGGPVEILSF
LYLGSAYHASRKDMLDALGITALINVSANCPNHFEGHYQYKSIPVEDNHKADISSWFNEA
IDFIDSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFS
FMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHPTNSALNYLKSP
ITTSPSC
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgatggaggtgggcatcctggacgccggggggctgcgcgcgctgctgcgagagggc
gccgcgcagtgcctgttgttggattgtcgctccttcttcgctttcaacgccggccacatc
gcgggctcagtgaacgtgcgcttcagcaccatcgtgcggcgccgcgccaagggcgccatg
ggcctggagcatatcgtgcccaacgctgaactgcgtggccgcctgctggccggagcctac
cacgccgtggtgctgctggacgagcgcagcgcctccctggacggcgccaagcgcgacggc
accctggccctggccgcgggcgcgctctgccgagaggcgcgctccactcaagtcttcttt
ctccaaggaggatatgaagcgttttcggcttcctgccctgagctgtgcagcaaacagtcc
acccccacggggctcagcctccccctgagtactagtgtgcctgacagtgcagaatccgga
tgcagctcctgtagtacccctctctacgatcaggggggcccagtggagatcctgtccttc
ctgtacctgggcagtgcctatcacgcttctcggaaggatatgcttgacgccttgggcatc
accgccttgatcaacgtctcagccaattgtcctaaccactttgagggtcactaccagtac
aagagcatccctgtggaggacaaccacaaggcagacatcagctcctggttcaacgaggct
attgacttcatagactccatcaaggatgctggagggagagtgtttgttcattgccaggcc
ggcatctcccggtcagccaccatctgccttgcttacctcatgaggactaaccgggtaaag
ctggacgaggcctttgagtttgtgaagcagaggcggagtatcatctccccgaacttcagc
ttcatgggccagctgctgcagtttgagtcccaagtgctagcccctcactgctctgctgaa
gctgggagccctgccatggctgtccttgaccggggcacctctactaccacagtcttcaac
ttccctgtttccatccccgtccaccccacgaacagtgccctgaactaccttaaaagcccc
atcaccacctctccaagctgctga

DBGET integrated database retrieval system