KEGG   Mus musculus (mouse): 19268
Entry
19268             CDS       T01002                                 

Gene name
Ptprf, AA591035, LAR, LARS, RP, RPTP-LAR
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, F
  KO
K05695  receptor-type tyrosine-protein phosphatase F [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
mmu04520  Adherens junction
mmu04910  Insulin signaling pathway
mmu04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    19268 (Ptprf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    19268 (Ptprf)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19268 (Ptprf)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    19268 (Ptprf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19268 (Ptprf)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19268 (Ptprf)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19268 (Ptprf)
SSDB
Motif
Pfam: Y_phosphatase fn3 I-set Ig_3 Pur_ac_phosph_N Ig_2 ig Interfer-bind fn3_2 DSPc C2-set_2 Y_phosphatase3 Ig_5 PTPlike_phytase Arylsulfotran_N Insulin_TMD ICAM_N DUF3377
Other DBs
NCBI-GeneID: 19268
NCBI-ProteinID: NP_035343
MGI: 102695
Ensembl: ENSMUSG00000033295
Vega: OTTMUSG00000008720
UniProt: A2A8L5 Q3V0J9
Structure
PDB: 
3PXH

Position
4; 4 D2.1
AA seq 1898 aa
MAPEPAPGRRMVPLVPALVMLGLMAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEDQLPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAAS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVMRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNTEPVSFYGIQYRAAGTD
GPFQEVDGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLPPQERI
VKYELVYWAAEDEGQQHKVTFDPTSSYTLEDLKPDTLYHFQLAARSDLGVGVFTPTVEAR
TAQSTPSAPPQKVTCVSTGSTTVRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVD
GISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVSWKLPVPNKQHGQIRGYQVTYVRLENGEPRGQPIIQDVMLAEAQETTISGLTP
ETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGRPTMMVSTTAMHTALLQWHPPKELPGE
LLGYRLQYRRADEARPNTIDFGKDDQHFTVTGLHKGATYVFRLAAKNRAGPGEEFEKEIT
TPEDVPSGFPQNLRVTGLTTSTTELTWDPPVLAERNGHITNYTVVYRDINSQLELQNVTN
DTHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVL
LSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQH
LVSIRTAPDLLPQKPLPASAFIEDGRFSLSMPQVQDPSLVRWFYIVVVPIDRVGGNLLAP
RWNTPEELELDELLEAIEQGEEKQRRRRRQAERLKPYVAAQVDVLPDTFTLGDKKSYRGF
YNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPEMLWVTGPVL
AVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNYQTPGMRDH
PPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNSEVNKPKNRYANVIAYDH
SRVLLTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMM
TRLEEKSRVKCDQYWPVRGTETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQF
QFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMK
HEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQ
VPPGESVTAMELEFKLLANSKAHTSRFVSANLPCNKFKNRLVNIMPYELTRVCLQPIRGV
EGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKC
HQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP
KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQ
TVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
NT seq 5697 nt   +upstreamnt  +downstreamnt
atggctcccgagccagccccagggaggaggatggtgccccttgtgcctgctctcgtgatg
cttggtttgatggcaggtgctcatggcgacagcaaacccgtctttgttaaggtccccgag
gaccagactgggctgtcgggaggggtggcctccttcgtgtgccaagccacaggggaaccc
aagcctcgaattacgtggatgaagaaggggaagaaagtcagctcccagcgctttgaggta
attgagtttgacgatggagcagggtcagtgctgcggatccagccattacgagtgcagcga
gacgaagccatctatgagtgcacagccacgaacagtctcggggagatcaacacaagtgcc
aagctgtcagtgcttgaagaggaccagctgccgtctgggttcccgactatcgacatggga
cctcagctgaaggtggtggagaagggtcgcactgccaccatgctgtgtgcagccggtggg
aacccagaccctgagatctcttggttcaaagacttccttcctgtggaccctgctgcaagc
aacggtcgtatcaaacagctgcgatcaggtgcattgcagatagagagcagcgaggagtct
gaccaaggcaagtacgagtgtgtggccaccaactctgcaggcacacgctactcggccccc
gccaacctgtatgtgcgagtgcgtcgcgtggctcctcgtttctccatccctcccagcagc
caagaggtgatgccgggcggcagcgtgaatctcacatgtgtggcagtgggcgcgcccatg
ccgtatgtgaaatggatgatgggcgccgaggaactgaccaaagaggatgagatgccagtc
ggccgaaatgttctggagctcagcaatgtcatgcgatctgccaactatacctgtgtggcc
atctcttcattaggcatgatagaagccacggcccaggtcacagtaaaagctctgccaaag
cctccaattgatcttgtggtgacagagacaaccgccaccagtgttactctgacatgggac
tctggaaataccgagcctgtgtccttctacggcatccagtaccgcgcagctggcacagac
ggccccttccaggaagtggatggtgtggccagcacccgatacagcattggtggcctcagc
cccttttcggaatatgctttccgtgtgttggctgttaacagcattgggcgaggaccaccc
agtgaggcagtgcgagcacgcacgggggagcaggcaccctccagccctccgcgccgtgtg
caggctcgaatgcttagcgccagcaccatgctggtccagtgggaaccacctgaagagccc
aatggcctggtacggggatatcgcgtctactataccccagattcccgacgccctttgagc
gcctggcacaagcataacactgacgcaggactccttaccaccgtgggcagcctgctacct
ggcatcacctacagcctccgagtccttgccttcactgctgtgggtgacggcccacccagc
cccaccatccaagtcaagacacagcagggagtgcctgcacagcctgcggacttccaggct
aacgctgagtcggacaccaggatccagctctcgtggctgctgcccccgcaggagcggatc
gtcaagtatgagctggtgtactgggcagccgaggatgagggccagcagcacaaggtgacc
ttcgaccccacctcctcctacactctggaggacctgaagcctgacacattgtaccacttc
cagctggctgcccgttcagatttgggggtgggcgtcttcacgcccaccgtagaggcccgt
acagcacagtccaccccatcagcccctccccagaaggtgacatgtgtgagcacgggctcc
accacggtccgggtaagttgggttccaccgccggccgacagccgcaacggcattatcacc
cagtactccgtggcctatgaggcagtggacggcgaagaccgtaagcgacatgtggtggat
ggcatcagccgtgagcattccagctgggacctgctgggcctggagaagtggacggagtac
cgggtgtgggtgcgggcacacacagatgtgggccctggccctgagagcagcccggtgctg
gtgcgcaccgatgaggacgtgcctagcgggccaccacggaaggtagaggttgagcctctg
aactccactgctgtgcatgtctcctggaagctgcccgtccccaacaagcagcacggacag
attcgtggctaccaggtcacctatgtgcggttggagaatggtgagccccgaggccaaccc
atcatccaggatgtcatgctggctgaggctcaggagaccaccatcagcggcctcaccccc
gagaccacctactccatcaccgtcgctgcctacaccactaagggggatggtgcccgaagc
aagcccaaggtggttactacaacaggggcagtcccaggacggcccaccatgatggtcagc
accacggccatgcacaccgcgctgctgcagtggcacccacccaaggagctgcctggagag
ctgctgggctaccgtctccaataccggcgggccgacgaggcgcggcccaacaccatagac
tttggcaaggatgaccaacattttacagtcaccggcctgcacaaaggggccacctacgtc
ttccggctcgctgccaagaaccgggctggcccaggagaagagtttgagaaagagatcacc
acccccgaggatgtgcccagtggctttcctcaaaatcttcgagtgacaggactgaccaca
tctaccacggaactgacctgggacccgccggtgctggcggagaggaatggtcacatcacc
aactatactgtggtctaccgtgacatcaacagccagcttgaactacagaatgtcaccaac
gacacacaccttacactcttgggccttaaaccggacaccacttatgacatcaaggtccgt
gcacataccagcaaaggcgccggccctctcagccccagcatccagtcccggaccatgccc
gtggagcaagtgtttgccaagaatttccgtgtggccgctgcgatgaagacatctgtgctg
ctcagttgggaggtccccgactcttataagtcagctgtgcccttcaagatcctgtacaat
gggcagagcgtggaggtggatgggcactcgatgcggaagctgattgcagacctgcaaccc
aacacggagtactccttcgtcctgatgaatcgtggcagtagcgccgggggcctacagcac
ctggtgtccatccgcactgccccggacctcctaccccagaagccactgcctgcctccgcc
tttatagaggatggccgcttctccctctccatgcctcaagtgcaggacccctcgctagtc
aggtggttctacattgtggtggtgcccattgaccgtgtgggcgggaacttgctggcacca
agatggaacacaccagaggagttggagctggacgagcttctggaggccatcgagcagggc
gaggagaaacagcggaggcgccggcgccaagcagagcggctgaagccttatgtggcggcc
caagtggatgtgctccctgacaccttcaccctgggggacaagaagagctaccgcggcttc
tacaaccggcccctgtctccggatctgagttaccagtgcttcgttctcgcctccctcaag
gaacccatggaccagaagcgctacgcctccagcccctactcggacgagattgtagtccag
gtgacgccagcacagcagcaggaggagcccgagatgctgtgggtgacaggccctgtcctg
gcggtcattctcatcatactcattgtcatcgccatcctcctgttcaagaggaagagaaca
cactccccatcatcaaaggatgagcagtcaatcgggctgaaggactccctgttggcccac
tcttctgaccctgtggagatgcgaaggcttaactaccagaccccaggtatgcgagaccac
ccgcccatccccatcactgacctggcagacaatattgagcgcctcaaagccaacgatggg
ctcaagttctcccaggagtatgagtccattgaccctggacagcagttcacatgggagaat
tccaactcggaggtgaacaagcccaagaaccgctatgcaaatgtcattgcctatgaccat
tctcgagtcctcctcacctccattgatggtgttcctgggagtgactacatcaatgccaac
tacattgatggctaccgaaagcagaatgcctacatcgccacacagggtccgctgcccgag
accatgggcgatttctggaggatggtgtgggaacagcgcacagccacagtggtcatgatg
accaggctagaggagaaatcccgggtgaagtgtgatcagtattggccagtccgtggcact
gagacctatggcctcattcaggtgaccctggtggacactgtggagttggccacatacacc
atgcgcacctttgccctccataagagtggctccagtgagaagcgtgagctgcgtcagttc
cagttcatggcctggccagaccacggcgttcctgagtaccccactcccatcttggccttc
ctgagacgggtcaaggcctgtaacccactagatgcggggcccatggtggtgcattgcagt
gcgggtgtggggcgcacaggctgcttcatcgtcatcgacgcaatgctggagcgtatgaag
cacgagaagacggttgacatctatggccacgtgacgtgcatgcgctcacaaaggaactac
atggtgcagaccgaggaccagtatgtgttcatccacgaggccctgctagaggctgccatg
tgcggacacaccgaggtgctcgctcggaacctctatgcccacatccagaagctaggccaa
gtgcctcccggggagagcgtcacggccatggaacttgagttcaagttgctggccaactcc
aaggcccacacgtcgcgctttgtcagtgccaacctgccctgcaacaagttcaagaaccgc
ctagtgaacatcatgccctatgagctgacccgagtgtgcttgcaacccatccgtggtgtg
gagggctcagactacatcaatgccagctttctagatggctacagacagcagaaggcctac
atagctacacaggggcctctggcagagagcaccgaggacttctggcgcatgttatgggag
cacaattccaccatcatcgtcatgctgaccaagcttcgggagatgggcagggagaaatgt
caccagtactggccagcagagcgctccgctcgctatcagtacttcgttgttgacccgatg
gctgagtacaacatgccccagtatattctgcgtgaattcaaagtcacagacgcccgggat
gggcagtcaaggacaatccgacagttccagtttacagactggccagagcaaggagtaccc
aaaacaggtgaaggcttcatcgacttcatcgggcaggtgcacaagacaaaggagcagttt
ggccaggatgggcccatcacggtgcactgcagtgctggtgtgggccgcaccggtgtgttc
atcaccctgagcattgtcctggagcgcatgcggtatgagggtgtggttgacatgttccag
accgtgaagaccctccgcacacagcgccctgcaatggtgcagacagaggaccaataccag
ctgtgctaccgtgcggccctggaatacctcggcagctttgatcactatgcaacgtaa

DBGET integrated database retrieval system