KEGG   Mus musculus (house mouse): 192775
Entry
192775            CDS       T01002                                 
Symbol
Kcnh6, m-erg2
Name
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 6
  KO
K04909  potassium voltage-gated channel Eag-related subfamily H member 6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    192775 (Kcnh6)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   192775 (Kcnh6)
SSDB
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_8 PAS_4 PAN_3
Other DBs
NCBI-GeneID: 192775
NCBI-ProteinID: NP_001032801
MGI: 2684139
Ensembl: ENSMUSG00000001901
UniProt: Q32ME0
Position
11:105898871..105926421
AA seq 950 aa
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYGTVSQ
IPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGAQLGKHYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
ASLHARPGKSSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFNLRDADGG
LHSTPRQAPGNQDPQGFFLNDSQSGAAPSLSISDTSGLWPELLQQMPPSPPNPREKLDCW
PRELGFKLEQLQAQMNRLESRVSSDLSRILQLLQHPQGHPGYILGAPASSDLALFPETSV
TQSSESMLLVGHLPSAQTLSYGDLDKHIRMPRNFSPRIPHVAAAMDKSLVPSSEQEQPKG
LLSPLASPLCPLEVQGLGGPHFSSLPEHLSSVPKQLEFQRHGSDPGFTRS
NT seq 2853 nt   +upstreamnt  +downstreamnt
atgccagtccgcaggggccacgttgctccccaaaacacttacttggacaccatcatccgc
aagtttgagggccagagtcgtaagttcctgattgccaatgcacagatggagaactgtgcc
atcatctactgcaatgatggcttctgcgaactcttcggctactcccgtgtggaggtgatg
cagcgaccctgtacctgtgacttcctcactggcccgaacactccgagcagtgctgtgtcc
cgcctggcgcaggccctgcttggggctgaagagtgcaaggtggacatcctctactatcgc
aaggatgcctccagcttccgctgcctggtggatgtggtccctgtgaagaacgaggatggg
gctgtcatcatgttcatcctcaatttcgaggacctggcccagctcctggccaagagcagc
agccgcagcctgacccaacgtttgttgtcacacagcttcctgggctctgagggctctcac
agcaggccaagcggacaggggcctggtccaggcaggggcaagtatggaactgtcagccag
atcccgcagttcacgctcagctttgtggagttcaacctggagaagcaccgctcaggctcc
accacagagattgagatcatcgctccccacaaggtggtggagcggacacagaatgtcact
gaaaaggtcacgcaggtcctgtccctgggtgcagatgtgctgccagagtacaagctgcag
gcaccgcgcattcaccgaggtaccattctgcactacagccccttcaaggctgtatgggac
tggctcatcttgctcttagtcatctatacagcggtcttcacgccctactctgctgccttt
ctgcttagcgaccaggacgactcacagcgtggtacctgcggctatacctgcagcccgctc
accgtggtggacctcatcgtggatatcatgtttgtggtggatattgtcatcaacttccga
accacctacgtcaacactaatgacgaggtggtcagccacccccgacgaatcgccgtccac
tatttcaagggctggttcctcattgacatggtggctgccatcccttttgacttgcttatc
ttccgcactggctcagatgagaccaccaccctgatcgggttactgaagacggcgcgcctc
ctacggctggtgcgcgtggcccggaagctggaccgctattctgaatacggggccgccgta
ctcttcctgctcatgtgtacttttgcgctcattgcgcactggctggcctgtatctggtac
gccatcggcaatgtggagcgaccctacttggagcccaagattggttggctggacagcctg
ggcgcgcagcttggcaagcactataacggcagcgacccagcctcgggaccctctgtccaa
gacaagtatgtcaccgccctctacttcaccttcagcagcctcactagtgtgggcttcggc
aatgtgtcacccaacaccaactctgagaaggtcttctctatctgcgtcatgctcattggc
tcacttatgtacgccagcatctttggcaacgtgtcggccatcatccagcgcctgtactca
ggcacggctcgctaccacactcagatgctgcgggtcaaggagttcatccgcttccaccag
atccccaacccactgaggcagcgcctggaagagtatttccagcacgcctggtcctacacc
aatggcatcgacatgaacgcggtgctgaaaggcttccctgagtgcctgcaggcggacatc
tgcctgcacctgcaccgcgctctgttgcagcactgccccgccttccgcggcgccagcaag
gggtgcctgcgcgcgctcgccgtcaagttcaagaccacgcacgcgccgcctggggacacg
ctggtgcacctgggcgacgtgctttccactctctacttcatctcccgcggctccatcgag
atcctgcgcgatgacgtggtcgtggccattctagggaagaatgacatctttggggagcct
gccagtctccatgccagaccaggcaaatcaagcgccgatgtgcgtgccctgacctactgc
gacctgcacaagatccatcgagcagacctgctggaggtgctggacatgtaccccgccttt
gcagataccttctggaataagctagaggtcaccttcaacctgcgggacgcagatgggggt
ctccactcaacaccccgacaggccccaggcaaccaagacccccaaggcttcttcctcaat
gacagccaatcaggtgctgccccttccctgagcatttcagacacatctgggctttggcct
gaattgctacagcaaatgcccccaagtcccccaaacccacgagagaagctggattgctgg
cctcgggagctaggctttaagttagaacagctccaagcccagatgaacagactggagtcc
cgcgtgtcgtcagacctcagccgcatcctacagctacttcagcatccacagggccacccc
ggctacatcttgggggcccctgcctccagtgacctggccttgtttcctgaaacttcagtg
actcagagttcagagtcgatgcttctggtgggacatctgccctctgcacagaccctaagc
tatggtgatttggacaaacatatccggatgcccaggaatttctcccccaggatacctcac
gtggccgcggcaatggacaaatctctggtgccgtcctcagaacaagagcagcccaagggg
ctcctgtcacctctggcctcacctctgtgtcccctggaagtacagggactgggtggtccc
cacttttcctccctccctgaacacctcagctccgttcccaagcagctggaattccagaga
cacggttcagatcctggattcacaaggagttag

DBGET integrated database retrieval system