KEGG   Mus musculus (mouse): 192897
Entry
192897            CDS       T01002                                 

Gene name
Itgb4, AA407042, C230078O20, CD104
Definition
(RefSeq) integrin beta 4
  KO
K06525  integrin beta 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    192897 (Itgb4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    192897 (Itgb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    192897 (Itgb4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    192897 (Itgb4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    192897 (Itgb4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    192897 (Itgb4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    192897 (Itgb4)
   05414 Dilated cardiomyopathy
    192897 (Itgb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    192897 (Itgb4)
   04515 Cell adhesion molecules [BR:mmu04515]
    192897 (Itgb4)
   04090 CD molecules [BR:mmu04090]
    192897 (Itgb4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   192897 (Itgb4)
  Exosomal proteins of bladder cancer cells
   192897 (Itgb4)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   192897 (Itgb4)
CD molecules [BR:mmu04090]
 Proteins
  192897 (Itgb4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 192897
NCBI-ProteinID: NP_001005608
MGI: 96613
Ensembl: ENSMUSG00000020758
Vega: OTTMUSG00000003650
UniProt: A2A864
Position
11 E2; 11 80.91 cM
AA seq 1802 aa
MAGPCCSPWVKLLLLAAMLSASLPGDLANRCKKAQVKSCTECIRVDKSCAYCTDELFKER
RCNTQAELLAAGCRGESILVMESSLEITENTQIDTSLHRSQVSPQGLQVRLRPGEERSFV
FQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVS
VPQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAI
LQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDASGAYTQY
KTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELL
EEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDID
GTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCELQKEVRSARCHFRGDFMCGH
CVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEY
DNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGRGYCEC
GRCHCNQQSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMV
DELKKEEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKDCPPGSFWWLIPLLI
FLLLLLALLLLLCWKYCACCKACLGLLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELVPYGLSLRLGRLCTENLMKPGTRE
CDQLRQEVEENLNEVYRQVSGAHKLQQTKFRQQPNTGKKQDHTIVDTVLLAPRSAKQMLL
KLTEKQVEQGSFHELKVAPGYYTVTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGVVSFEQPEYSVSRGDQVARIPVIRHILDN
GKSQVSYSTQDNTAHGHRDYVPVEGELLFHPGETWKELQVKLLELQEVDSLLRGRQVRRF
QVQLSNPKFGARLGQPSTTTVILDETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRK
IHFNWLPPPGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQ
GEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNE
DNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKR
PMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTEHLVNGRMDFAYP
GSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRDYSTL
TSLSSQGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGTD
SRGAVGVPDTPTRLVFSALGPTSLKVSWQEPQCDRMLLGYSVEYQLLNGGEMHRLNIPNP
GQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFTLST
PSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGAPARTFRVDGDNPESR
LTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVGGPFPQLGSHSGLFQNPVQSEF
SSVTSTHSTTTEPFLMDGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFF
QT
NT seq 5409 nt   +upstreamnt  +downstreamnt
atggcagggccctgttgcagcccatgggtgaagctgctgctgctggcagcaatgctgagt
gccagcctccctggagacctggccaaccgctgcaagaaggctcaggtgaagagctgtacc
gagtgcatccgggtggacaagagctgtgcctactgcacagacgagctgttcaaggagagg
cgctgcaacacccaggcggagcttctggctgcaggctgcaggggagagagcatcctggtc
atggagagcagccttgaaatcacagagaacacccagatcgacaccagcctgcaccgcagc
caggtatctccccaaggcctgcaagtccggctgcggccgggtgaggagcgcagctttgtg
ttccaggtgtttgagcccctggagagccccgtggatctgtatatcctcatggacttctcc
aactccatgtctgacgatctggacaacctcaagcagatggggcagaacctggccaagatc
ctgcgccagctcaccagcgactacaccattggatttggaaagtttgtggacaaagtcagc
gtcccacagacagacatgaggcccgagaaactgaaggagccctggcccaacagtgatccc
ccgttctccttcaagaacgttatcagcttaacggagaatgtggaagaattctggaacaaa
ctgcaaggagaacgcatctcaggcaacctggacgctcctgaagggggctttgatgccatc
ctgcagacagctgtgtgcacaagggacattggctggagggctgacagcacccacctgctg
gtgttctccaccgagtctgccttccactacgaggctgatggtgccaacgtgctggccggc
atcatgaaccgcaatgatgagaaatgccacctggacgcctcgggcgcctacacccaatac
aagacacaggactacccatcagtgcccacgctggttcgcctgcttgccaagcataacatc
atccccatctttgctgtcaccaactactcttacagctactatgagaagctccataagtat
ttccccgtctcctctctgggcgtcctgcaggaggattcatccaacatcgtggagctgctg
gaggaggccttctatcgaattcgctccaacctggacatccgggctctggacagccccaga
ggcctgagaacagaggtcacctccgatactctccagaagacggagactgggtcctttcac
atcaagcggggggaagtgggcacatacaatgtgcatctccgggcagtggaggacatagat
gggacacatgtgtgccagctggctaaagaagaccaagggggcaacatccacctgaaaccc
tccttctctgatggcctccggatggacgcgagtgtgatctgtgacgtgtgcccctgtgag
ctgcaaaaggaagttcgatcagctcgctgtcacttcagaggagacttcatgtgtggacac
tgtgtgtgcaatgagggctggagtggcaaaacctgcaactgctccaccggctctctgagt
gacacacagccctgcctgcgtgagggtgaggacaaaccgtgctcgggccacggcgagtgc
cagtgcggacgctgtgtgtgctatggtgaaggccgctacgagggtcacttctgcgagtat
gacaacttccagtgtccccggacctctggattcctgtgcaatgaccggggtcgctgttct
atgggagagtgtgtgtgtgagcctggttggacaggccgcagctgtgactgtcccctcagc
aatgccacctgcatcgatagcaacgggggcatctgcaacggccgaggctactgtgagtgt
ggccgttgtcactgcaaccagcagtcgctctacacggacaccacctgtgagatcaactac
tctgcgatacgcctgggtctctgtgaggatctccgctcctgcgtacagtgccaggcctgg
ggcaccggggagaagaaagggcgcgcgtgtgacgattgcccctttaaagtcaagatggta
gacgagcttaagaaagaagaggtggtggagtactgctccttccgggatgaggatgacgac
tgcacttacagctacaacgtggagggcgatggcagccctgggcccaacagcacagtcctg
gtccacaaaaagaaagactgccctcccggctccttctggtggctcatccccctgctcatc
ttcctcctgttgctcctggcgttgcttctgctgctctgctggaaatactgtgcctgctgc
aaagcctgcctggggcttcttccttgctgcaaccgaggtcacatggtgggctttaaggaa
gatcactatatgcttcgggagaacctgatggcctctgaccacctggacacgcccatgcta
cgaagcgggaacctcaagggacgagacacagtccgctggaagatcaccaacaatgtgcag
cgccctggctttgccacccatgccgccagcaccagccccacggagctcgtaccctacggg
ctgtccctgcgccttggccgcctctgcactgagaaccttatgaagccgggcacccgagag
tgtgaccagctacgccaggaggtggaggaaaatctgaatgaggtgtatagacaggtcagc
ggcgcacacaagctccagcagacgaagttccgacagcagcccaacaccgggaaaaagcaa
gaccacaccattgtggacacagtgttgctggcgccccgctccgccaagcagatgctgctg
aagctgacagagaagcaggtggagcaggggtccttccatgaactgaaggtggcccctggc
tactacactgtcacggcagagcaggatgcccggggcatggtggagttccaggagggcgtg
gagctggtggatgtgcgagtgcccctcttcatccggcctgaggatgatgatgagaagcag
ctgctggtggaggccattgatgtccctgtgggcactgccacccttggtcgccgtctggta
aacatcaccattatcaaggaacaagctagtggggtagtgtccttcgagcagcctgaatac
tcggtgagtcgtggagaccaggtggcccgcatccctgtcatccggcacatcctggacaat
ggcaagtcccaggtctcctatagcacacaggataatacagcacacggacaccgggattat
gtccctgtggagggagagctgctgttccatcctggggagacctggaaggagttgcaggtg
aagctactggagctgcaggaggtcgactccctcctgcgtggccgccaggtccgccgcttc
caagtccaactcagcaaccccaagttcggagcccgcctgggccagcccagcacaaccacc
gttattctcgatgaaacggacaggagtctcataaatcaaacactttcatcgcctccgcca
ccccatggagacctgggcgccccacagaaccccaatgccaaggctgccgggtccaggaag
atccatttcaactggctgccccctcctggcaagccaatggggtacagggtgaagtactgg
atccagggcgactctgagtctgaagcccaccttctagacagcaaggtgccctcagtggaa
ctcaccaacctgtatccctattgcgactacgaaatgaaggtgtgtgcctatggggcacag
ggtgaggggccctatagctcactggtgtcctgccgcacccaccaggaagtacccagcgag
ccagggaggctggctttcaatgtagtctcttctacggtgacgcagctgagctgggcagag
ccagctgagaccaatggcgagatcacagcctacgaggtctgctatggactggtcaatgag
gacaaccgacccattggacctatgaagaaggtgctcgtggacaaccccaagaaccggatg
ctgctcattgagaatctgcgagaatcccagccataccgatacacggttaaggcgcgcaat
ggggcaggatggggacccgagagagaggctatcatcaacctggctacacagcccaagcgg
cccatgtccatccctatcatcccagacatccccatagtggacgcccagggtggagaagac
tacgaaaacttccttatgtacagtgatgacgtcctgcggtccccagccagcagccagagg
cccagcgtttctgatgacactgagcacctggtgaatggccggatggactttgcctatcca
ggcagcgccaactccctgcacagaatgactgcagccaatgtggcctatggcacgcatctg
agcccacacctgtcccaccgagtgctgagcacgtcctccacccttacccgggactaccac
tctctgacacgcacagagcactcccactcaggcacacttcccagggactactccaccctc
acttccctttcctcccaaggcctccctcctatctgggaagatgggaggagcaggcttccg
ctgtcctggactcttgggtccttgagccgggctcacatgaagggtgtgcccgcatccagg
ggttcaccagactctataatcctggccgggcagtcagcagcaccctcctggggtacagat
tcccgtggggctgtgggtgtgcctgacacacccactcggctggtgttctctgccctgggg
cccacgtctttgaaggtgagctggcaggagccacagtgtgatcggatgctgctgggctac
agtgtggaataccagctactaaacggcggcgagatgcatcggctcaacatccctaaccct
ggccaaacctcggtggtggtagaggatctcctgcctaaccactcctatgtgttccgggta
cgggcccagagccaggagggctggggccgagagcgagagggtgtcatcaccatcgagtcc
caggtgcacccgcagagccctctctgccccctgccaggctcagccttcactctgagcacc
cccagcgccccgggaccgctggtgttcactgccctaagcccagactccctgcagctcagc
tgggagcggccgaggaggcccaatggagatatccttggctacctggtgacctgtgagatg
gcccaaggaggagcaccagccaggaccttccgggtggacggagacaaccctgagagccgg
ttgactgtacctggcctcagtgagaacgttccttacaagttcaaggttcaggccaggacg
accgagggcttcgggccagagcgtgagggtatcatcaccatcgagtctcaggttggaggc
cccttcccacagctgggcagccattctgggctcttccagaacccagtgcaaagcgagttc
agcagcgtgaccagcacgcacagcaccacgactgagcccttcctcatggatggtctaacc
ctggggacccagcgcctggaagcaggaggctccctcacccggcatgtgacccaggaattc
gtgacccggaccttaacggccagtggctctctcagcactcatatggaccaacagttcttc
caaacctga

DBGET integrated database retrieval system