KEGG   Mus musculus (mouse): 19302
Entry
19302             CDS       T01002                                 

Gene name
Pex2, D3Ertd138, D3Ertd138e, PAF-1, PMP, PMP35, Pxm, Pxmp3
Definition
(RefSeq) peroxisomal biogenesis factor 2
  KO
K06664  peroxin-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19302 (Pex2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    19302 (Pex2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    19302 (Pex2)
SSDB
Motif
Pfam: Pex2_Pex12 zf-C3HC4 zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-C3HC4_4 zf-RING_UBOX zf-RING_2 zf-RING_6 zf-RING_5
Other DBs
NCBI-GeneID: 19302
NCBI-ProteinID: NP_001156773
MGI: 107486
Ensembl: ENSMUSG00000040374
Vega: OTTMUSG00000051256
UniProt: P55098 Q91YZ5
Position
3 A1; 3 1.96 cM
AA seq 305 aa
MTGKEENMQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL
WLFLWRFTIYSKNATVGQSVLNIQYKNDSSLNLIYQPPSKTQKLWYAVCTIGGKWLEERC
YDLFRNRHLASFGKAKQFMNFLVGLLKLGELINFLIFLQKGKFATLTERLLGIHSVFCKP
QNMREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKLSSWCIPLTGAAGHDSTLGSS
GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDIYFTCPKCGTEVHSVQPLKSGIEMS
EVNAL
NT seq 918 nt   +upstreamnt  +downstreamnt
atgactggcaaagaagagaatatgcagagtgcaaacagagtgctgaggataagtcagttg
gatgcacttgaactgaataaggccctggagcagcttgtgtggtcccagtttactcagtgc
tttcatggatttaagccaggactgttagctcgctttgagccagaagtgaaagcatttctg
tggcttttcctatggaggttcaccatctactccaaaaatgccactgtggggcagtcagtt
ttaaatattcagtacaaaaatgattcttctctcaacctgatataccagccaccgagtaaa
actcagaaactgtggtatgctgtgtgcaccattgggggaaagtggttagaagaacgatgt
tatgatttgtttcgaaaccgtcatttagcgtcttttgggaaagccaaacagttcatgaat
tttctggttggacttttaaaattaggtgagttgataaacttcttgattttcctacaaaag
ggaaagtttgcaactttgacagaacgcctccttggcattcattccgtattttgcaagccc
cagaacatgcgcgaagttggctttgagtacatgaatagggaacttctctggcatggcttt
gctgagtttctgatttttctcttaccacttatcaatatccagaagttgaaagccaaattg
tcttcctggtgtatccctcttactggtgctgctggtcatgacagtacactaggcagcagt
ggaaaagagtgtgctctgtgtggagagtggcccacaatgcctcacactattggatgtgaa
catgtattttgttactactgtgttaagagtagcttcctatttgacatatactttacgtgc
ccgaagtgtggcacagaagtgcacagtgtgcagcccttgaaatcaggaattgaaatgtca
gaagtaaatgctctttag

DBGET integrated database retrieval system